(data stored in ACNUC7421 zone)

EMBL: CP001743.PE462

CP001743.PE462       Location/Qualifiers
FT   CDS_pept        complement(452418..452948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0467"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; SPTR: A2XMU9
FT                   Putative uncharacterized protein; InterPro IPR000182; COGs:
FT                   COG1670 Acetyltransferase including N-acetylase of
FT                   ribosomal protein; KEGG: bca:BCE_1891 acetyltransferase;
FT                   PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27244"
FT                   /protein_id="ADD27244.1"
FT                   /translation="MELRGPRLLLRPPRLEDTEALFALMSDPEMAPFVYWNPHQSPDET
FT                   YQYLGHLQTKEGFFIIEAEGRPAGVIGLHLDWPNKLGETETWLGRPYWGCGINTEAKVV
FT                   LFDFAFGPWDLRRIQAIAHVHNPRSQRALEKLGFQREGLLRRWRWIRGEPWDFYMYSLL
FT                   PEEWMSSRPPIFY"
     atggaactgc gcggcccccg gcttctgctc cgcccccctc ggctcgagga caccgaggcg        60
     ctgttcgcgc tgatgtccga ccccgagatg gccccctttg tctactggaa cccccaccag       120
     agccccgacg aaacctacca gtacctgggg catctgcaga ccaaggaggg ttttttcatc       180
     atcgaggccg agggaaggcc ggcgggggtg atcgggctgc acctggactg gcccaacaag       240
     ctgggcgaga ccgagacctg gctggggcgg ccctactggg gctgtggcat caacaccgag       300
     gccaaggtgg tgctcttcga ttttgccttt gggccctggg atctgcgccg catccaggcc       360
     attgcccacg tgcataaccc ccgctcgcag cgggcgctgg aaaaactggg cttccagcgc       420
     gaggggcttc tgcgccgctg gcgctggatc cggggagagc cctgggattt ttacatgtac       480
     agcctgctac ccgaggagtg gatgtcgagc cggcccccca tcttttactg a                531
//

If you have problems or comments...

PBIL Back to PBIL home page