(data stored in ACNUC7421 zone)

EMBL: CP001743.PE463

CP001743.PE463       Location/Qualifiers
FT   CDS_pept        complement(453008..455590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0468"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; protease-associated PA domain protein; SPTR:
FT                   Q6H8Q3 Subtilisin-like protease (Fragment); InterPro
FT                   IPR000209:IPR003137; COGs: COG1404 Subtilisin-like serine
FT                   protease; KEGG: scl:sce3689 subtilisin like protease; PFAM:
FT                   Subtilase family; Domain of Unknown Function (DUF1034)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27245"
FT                   /protein_id="ADD27245.1"
FT                   /translation="MRKLLLLVGMSALLAACGGPRSSKPSLEVIASLPPAPASPMVDET
FT                   PTRWFVELSGGAVSDGISLQSIQAQHAAFRQAAQAAGVKILFAYTQLFNGFSVEVPGNN
FT                   RKLLYTLPGVEGVYPIGTYKLPPREAANPDLASAITQTGADIAQNDLGLTGRGVKVGII
FT                   DSGIDLEHPAFAGRIVDGYDFVGDAYDASDPAKSTPVPDPNPDDCDGHGTHVAGIVGGK
FT                   DSQITGVAPGVQFGAYKVFGCEGSTGDDVILAALERAETAGMDVVNMSLGSPFGWSVLG
FT                   KSITKMVKRGTVVVASAGNNGNLGLFATGDPAATEGVLSVASFDNIAVNAQKAVVNATG
FT                   APLGYLVLGGAEAPPTSGTSAEVVWVGRGCNADALLADPNGKVALMERGACTFNEKYQK
FT                   AVAAGAVGVIIHNNAPGLFAGGGVAGVAGKFGISISQADGLALRGLTSPTTLTWTPDTT
FT                   QVSNPTGNLISSFSSWGLSQDLKLKPDLGAPGGLIRSAVPLEQGSYAILSGTSMSAPHV
FT                   AGAVALLLEGNPAFWGPQKPSEVRKYLQNTAMPKLFALAPSSGLPETSYREGAGMIDIV
FT                   AAVQNRVTVTPSAISFAEKAGTHTERLVLKNRSNVPLIYRPVHLPGPSAFGSIYSPSFA
FT                   IAPATVSFSHTQVTVPARGEAVLTVTITPPAGLPNKGLFGGYILLQPVGAGLMMNVPYV
FT                   GMQGGYQAVQILTPASAGFPLLGKLNAAGTGYDLLPSGGTFTLQGNDLPVVLAHFEHGA
FT                   QVYEMVILNAATNAPIHPKYSRADYGEYIPRNSSANGFFAIPWDGTRITRYAKEDVYGN
FT                   KIPVPSEFQAVPDGQYKLQLRVLKPTGRMSNPADWESWISPVITIDRP"
     gtgcgaaagc tacttttgct agtcgggatg tcggctctac tggcagcctg tgggggcccc        60
     aggagcagca aacccagcct cgaggtcatc gcgtccctac ccccggcccc cgccagccca       120
     atggtagatg aaacccccac ccgctggttt gtggagctct ccgggggtgc tgtaagcgac       180
     ggcatcagct tacagagcat ccaggcccag cacgccgcct tccgccaggc cgcccaggcc       240
     gccggggtca agattctgtt cgcctacact cagcttttca acggcttttc cgtagaagta       300
     ccgggcaata accgcaaact gctctacacc ctgccaggcg tggaaggggt ctaccccatc       360
     ggcacctaca aacttccccc gcgtgaggca gccaaccccg atctggccag cgccatcacc       420
     cagaccgggg ccgacatcgc gcaaaacgac ctgggcctga ccgggcgggg ggtcaaggtg       480
     ggcatcatcg actcgggtat cgacctcgag caccccgctt ttgcgggccg aatcgtggac       540
     ggctacgact tcgtgggcga tgcctacgac gcctccgacc ctgcgaagtc cacccccgtg       600
     cccgacccca accccgacga ctgcgacggc cacggcaccc atgtggccgg gattgtgggc       660
     ggtaaggaca gccaaattac cggcgtggcc ccaggggttc aattcggcgc ctacaaggtg       720
     tttggttgtg agggttccac cggtgacgac gtgatcctgg ccgcgctcga gcgggccgag       780
     accgccggca tggacgtggt caatatgagc ctgggctccc ccttcggctg gagcgtgctg       840
     ggcaaatcca tcaccaagat ggtcaaacgc ggcaccgtgg tggtggcctc cgccggcaac       900
     aacggcaacc tgggcctctt tgctaccggc gaccctgccg ccaccgaggg cgtgctgagc       960
     gtagcctctt tcgacaacat tgcggtgaat gcccagaaag ctgtggtcaa tgccaccggg      1020
     gccccgctgg gctacctggt gctgggcggg gccgaagccc cccccaccag cggcaccagc      1080
     gccgaggtgg tctgggtggg ccggggctgc aacgccgatg ccctgctggc cgaccccaac      1140
     ggcaaggtgg ccctgatgga acgcggggcc tgcaccttca acgaaaagta ccagaaagcc      1200
     gtggccgctg gggcggtggg cgtgatcatc cacaacaacg cccccggcct gtttgccggc      1260
     ggtggggtgg ccggtgtggc cggcaagttc ggcatcagca tctcccaggc cgatggcctg      1320
     gccctgcgcg gcctgaccag ccccaccacc ctcacctgga cacccgacac cacccaggtc      1380
     agcaacccca ccggcaacct gatctccagc tttagctcct ggggtctgag ccaggatctg      1440
     aagcttaaac ccgacctggg cgctccgggt ggcctgatcc gctcggcggt acccctggag      1500
     cagggcagct acgccatcct gagcggcacc tcgatgtcgg ccccgcacgt ggccggcgcg      1560
     gtggcactgc tgctagaagg caaccccgcc ttctggggcc cacaaaaacc cagcgaggtg      1620
     cgcaagtacc tgcaaaacac cgccatgccc aagctcttcg ccctggcccc gagctccggc      1680
     ctgcccgaga ccagctaccg cgagggcgca gggatgattg acatcgtggc ggcggtgcag      1740
     aaccgggtga ccgtgacccc ctcggccatc tcctttgccg agaaagccgg cacccacacc      1800
     gagcggctag tgctgaagaa ccgcagcaac gtgccgctca tctaccggcc cgtccacctg      1860
     cccggcccct cggccttcgg cagcatctac agccccagct ttgccattgc cccagccacg      1920
     gtgagcttta gccacaccca ggtcaccgta ccggcccggg gtgaggccgt gcttacggtc      1980
     accatcaccc cgcccgcagg cctacccaac aagggcctgt ttggcggtta tatcctcctg      2040
     cagccggtgg gcgcgggcct catgatgaac gtgccctacg taggaatgca gggcggctac      2100
     caggcggtgc agattctgac cccggcctcc gcaggcttcc ccctgctcgg caagcttaac      2160
     gccgccggca ccggttacga cctgctcccc agcggtggca ccttcaccct gcagggcaac      2220
     gacctgccag tggtgctggc ccacttcgag cacggggccc aggtctacga gatggtgatt      2280
     ctgaacgcgg ccaccaacgc ccccattcat cccaagtaca gccgggccga ctacggcgag      2340
     tacatcccgc gcaactccag cgccaacgga ttctttgcca ttccctggga cggcacccgc      2400
     atcaccaggt acgctaaaga agatgtctac ggcaacaaga taccggtgcc cagtgagttc      2460
     caggctgtgc ccgatgggca gtacaagctg caactgcggg tgctcaagcc caccggcagg      2520
     atgagcaacc ccgccgactg ggagagctgg atctcaccgg tcatcaccat tgaccgtccg      2580
     taa                                                                    2583
//

If you have problems or comments...

PBIL Back to PBIL home page