(data stored in ACNUC7421 zone)

EMBL: CP001743.PE465

CP001743.PE465       Location/Qualifiers
FT   CDS_pept        457290..457997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0470"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="TIGRFAM: endonuclease III; PRIAM: DNA-(apurinic or
FT                   apyrimidinic site) lyase; PFAM: HhH-GPD family protein;
FT                   InterPro IPR003265:IPR004036:IPR005759; SPTR: A2UA93
FT                   Endonuclease III; KEGG: sfu:Sfum_1062 endonuclease III;
FT                   COGs: COG0177 EndoIII-related endonuclease; SMART: HhH-GPD
FT                   family protein; PFAM: Iron-sulfur binding domain of
FT                   endonuclease III; HhH-GPD superfamily base excision DNA
FT                   repair protein; TIGRFAM: endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27247"
FT                   /protein_id="ADD27247.1"
FT                   /translation="MPKVPKATSPKPKDKAQGSSGRESLKAKKQRAQRILAVMEQLYPQ
FT                   AATELQHKNPFELLIATVLSAQATDASVNKATPALFQRYPDAFALAQATPEEVEPYIKT
FT                   IGLYRSKARNIVLLARRLVEQHGGEVPVDKAKLRALPGVGWKTATVVLGAAFGVPGIAV
FT                   DTHLTRLAARLGLSAQKDPEKIGGDLERLFPKEKWVFVHHALILFGRYRCTARKPQCPG
FT                   CPLYDDCLSQGAW"
     atgccgaaag taccaaaggc taccagccca aagccgaagg acaaagcgca gggctcgagc        60
     gggagggaat cgctcaaagc caaaaagcaa cgggcccagc gaattctggc ggttatggag       120
     cagctctacc cgcaggccgc caccgagcta cagcacaaga acccctttga gctgctaatt       180
     gccacggtgc tctcggccca ggccaccgac gcctcggtga acaaggccac cccggccctc       240
     ttccagcgct accccgatgc gtttgccctg gcccaggcca cacccgaaga ggtggagccc       300
     tacatcaaga ccatcggcct gtaccgttcc aaggccagga atatcgtgct gctggcccgc       360
     cgcctggtgg agcagcacgg gggggaggtg ccagtggaca aggccaagct gcgcgcgctg       420
     ccgggggtgg gctggaagac cgccacggtg gtgctggggg cggcctttgg ggtgccgggg       480
     attgcggtgg acacccacct gacccgcctg gccgcccggc tgggcttgtc ggcccagaaa       540
     gaccccgaga aaatcggggg cgacctcgag cgcctcttcc ccaaggagaa gtgggtgttt       600
     gtgcaccacg cgctgattct ttttggccgc taccgctgta cagcccgtaa gccgcagtgc       660
     ccgggctgcc ccctgtacga cgactgcctg agccaagggg cttggtag                    708
//

If you have problems or comments...

PBIL Back to PBIL home page