(data stored in ACNUC7421 zone)

EMBL: CP001743.PE467

CP001743.PE467       Location/Qualifiers
FT   CDS_pept        458380..459342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0472"
FT                   /product="protein serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="PRIAM: Phosphoprotein phosphatase; PFAM: Protein
FT                   phosphatase 2C-like; SMART: protein phosphatase 2C domain
FT                   protein; InterPro IPR014045:IPR001932:IPR000585; KEGG:
FT                   ank:AnaeK_0770 protein serine/threonine phosphatase; COGs:
FT                   COG0631 Serine/threonine protein phosphatase; SPTR: A5ZMI4
FT                   Putative uncharacterized protein; PFAM: Protein phosphatase
FT                   2C"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27249"
FT                   /protein_id="ADD27249.1"
FT                   /translation="MPGSDSLPMVFTAALTDPGRKRALNEDAVTQLVTPYGGIFIVADG
FT                   MGGHRTGEVASQMAVSQILEILRHKEPSPQGLLEAYEAANEAIYLAGQKPESRGMGTTC
FT                   TTLWLDLPYALIAHVGDSRAYLLRDGELMQLTQDHSWVADRVRQGLLSEEEARNHRWRN
FT                   VITNALGSFSSARVDLVGLKVRPGDVFLLCSDGLSGVLEDRVLAEMILTNPPEPAVVKL
FT                   VKLANDWGGPDNISAVVVTIGSQVAENPRPYALPLEASEGRPVRLQSGSDPEVLTTQIV
FT                   EPERKVTFWQRWGSLILLLLWFGLLGFVLFNQFGTGSTP"
     atgccgggct ccgacagcct acccatggtg ttcactgcgg ccctgaccga cccgggtcgc        60
     aagcgggccc tcaacgagga tgcggttacc caactagtaa cgccctacgg cggtattttt       120
     attgtggccg acggtatggg gggccaccgc accggcgagg tggcctcgca gatggccgtc       180
     agtcagatat tggagattct cagacataag gagccctcgc cccaaggcct gctcgaggct       240
     tacgaggctg ccaacgaggc catctatctg gccggacaga agcccgagtc gcgggggatg       300
     ggcaccacct gcacaaccct ctggctcgac ctgccctatg ccctgatcgc ccatgtgggc       360
     gactcgaggg cctacctgct gcgcgacggc gagcttatgc aactcaccca ggatcactcc       420
     tgggtggccg atcgggtacg gcagggcctg ctcagcgaag aagaagcccg caaccaccgc       480
     tggcggaacg tgatcaccaa cgccctgggc tccttctcca gcgcgcgggt ggatctggtg       540
     ggcctgaagg tgcgccctgg cgatgtgttt ttactctgct ccgacggcct cagcggggtg       600
     ctggaagaca gggtgctggc cgagatgatc ctgaccaatc cccctgagcc ggcggtggtt       660
     aagctggtga agctggccaa cgactgggga ggccccgaca acatcagcgc ggtggtggtg       720
     acgattggca gccaggtggc tgagaatccc aggccctacg ctttgcccct ggaagccagt       780
     gaggggcgcc ctgtgcgact gcaaagcggc agcgaccccg aggtgctcac cacccagatt       840
     gtcgaaccgg agaggaaggt cactttctgg cagcgctggg gtagtctgat tctgctcctg       900
     ctgtggtttg gtctactggg ctttgttctg ttcaaccaat ttggtacagg gtctaccccg       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page