(data stored in ACNUC7421 zone)

EMBL: CP001743.PE47

CP001743.PE47        Location/Qualifiers
FT   CDS_pept        complement(41328..41819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0048"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="PFAM: Appr-1-p processing domain protein; SMART:
FT                   Appr-1-p processing domain protein; InterPro IPR002589;
FT                   KEGG: sfu:Sfum_0998 Appr-1-p processing domain protein;
FT                   COGs: COG2110 phosphatase homologous to the C-terminal
FT                   domain of histone macroH2A1; SPTR: A8A9L9 Appr-1-p
FT                   processing domain protein; PFAM: Macro domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26829"
FT                   /protein_id="ADD26829.1"
FT                   /translation="MARIQVAQGDITEFAGDAIVNAANNHLILGSGVAGAIRRRGGPSI
FT                   QGECDRHGPIRVGEAALTGAGQLPVRKVIHAAVLGDQPATLDTVRSATQAALRLALEHR
FT                   LYRLAFPLLGTGVGGLGVPQVAEVMLDELEAAPDPLEITLYGYSQADAEAIRQALARRR
FT                   "
     atggcccgca tccaggtggc ccagggtgac atcaccgagt ttgccggcga cgccatcgtc        60
     aacgcagcca acaaccacct cattctggga agtggcgtgg ccggggccat ccggcgcagg       120
     ggcggcccca gcattcaggg ggagtgtgac cgccacgggc ccatccgggt gggcgaggcg       180
     gccctcaccg gggccggcca gctacccgtg cgcaaggtga ttcacgcggc ggtgctgggc       240
     gaccagcccg ctaccctgga caccgtccgc agcgctaccc aggccgccct gcggctggcc       300
     ctggagcacc ggctctaccg gctggccttt cccctgctgg gcaccggggt gggcgggctg       360
     ggcgtgcccc aggtggcaga agttatgctg gacgagctcg aggccgcccc cgacccgctg       420
     gagatcaccc tgtacggcta cagccaggcc gacgccgagg ccatccggca ggccctggcc       480
     cggcgccgct aa                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page