(data stored in ACNUC7421 zone)

EMBL: CP001743.PE485

CP001743.PE485       Location/Qualifiers
FT   CDS_pept        477485..478153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0490"
FT                   /product="sigma-70 region 4 domain protein"
FT                   /note="PFAM: sigma-70 region 4 domain protein; InterPro
FT                   IPR007630; KEGG: nar:Saro_3770 regulatory protein, LuxR;
FT                   PFAM: Sigma-70, region 4"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27267"
FT                   /protein_id="ADD27267.1"
FT                   /translation="MPKKTPGQYFLSKGISPSQLADRLEQLYPLEREVLLARASGETLR
FT                   AIGGRLDLTPEGVRQVEIRALKKLREEDDTAQIQGRRFRLAVEQRLGVPLEKAVEGLPE
FT                   PQPMLVLAYARGEPLADLAPTLGLSITEATALRDQAVACLLGEDRGSRAGKWAELKAAV
FT                   AAALIESPLTYDDLEARFPMSRRRLMKLMQELVNEGRAELSDEYPFRFLGVKPPQRALD
FT                   "
     atgcccaaaa agacgccggg acaatatttt ctgagcaagg gtatatcgcc gagccaactg        60
     gccgatcgcc tcgagcaact ctatcccctc gagcgcgagg tcttgctggc ccgggcatcg       120
     ggcgagaccc tgcgggccat tggggggcgg ctcgacctga cccctgaagg ggtgcgccag       180
     gtggagattc gcgccctcaa aaaactccgt gaagaagacg ataccgcgca aattcagggc       240
     cgtcgttttc gcctggctgt tgaacagcgc ctgggagtac cgctggagaa agcggttgag       300
     ggattgcccg aaccccagcc catgctggtt ttagcctatg cccggggcga accgctggcc       360
     gatctggccc ctaccctggg gttgagcatc accgaggcca ccgccctgcg tgaccaggcg       420
     gtggcgtgct tgctgggtga ggatcggggc tcgagggccg gcaagtgggc cgagctaaaa       480
     gcagcggtag cagcagcctt aatcgagagt ccgctcacct acgacgacct cgaggcccgc       540
     tttcctatgt cccgccgacg cctgatgaag ctgatgcagg agctggtgaa cgaaggccgg       600
     gccgagctga gcgatgagta cccgttccgc tttttggggg ttaaaccgcc ccaacgggct       660
     ttggactga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page