(data stored in ACNUC7421 zone)

EMBL: CP001743.PE487

CP001743.PE487       Location/Qualifiers
FT   CDS_pept        479999..480934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0492"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; SPTR: A0ZD71 Putative
FT                   uncharacterized protein; InterPro IPR001395; COGs: COG0667
FT                   oxidoreductase (related to aryl-alcohol dehydrogenase);
FT                   KEGG: hypothetical protein; PFAM: Aldo/keto reductase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27269"
FT                   /protein_id="ADD27269.1"
FT                   /translation="MSEQIQIKGLPAIPPLGIGTWQWGDRLVWGYGNGYQAGDTEAAYR
FT                   AALQGGVRLFDTAEFYGFGLSERLIGRYRQAYEPKPLVVSKLFPYPWRFSRKTLFAALK
FT                   KSLQRLQMQQLDLYLLHWPWKPVPLEQWALSLAEAYEQGLTRAVGVSNHNLQQLERVAK
FT                   VLDQHRVPLAVNQVEYHLLERKPERTGLLRAMQAEGIVLMAYSPLAMGWLTGKYGLDNP
FT                   PPGRYRAQRYVTRKAQIPALLQALNEIAESLGATPAQVALRWCIQKGTLPIPGAKNACQ
FT                   AEGNAGALRICLSEAQMARLDALSGGEGPG"
     gtgagcgagc agattcagat caagggactt ccggccatcc cgcccctggg cattggcacc        60
     tggcagtggg gcgaccggct ggtctggggc tacggcaatg gctaccaggc aggcgatacc       120
     gaggcggcct accgggcggc cttgcagggt ggggtgcggc tttttgacac tgccgagttc       180
     tatggttttg gtctttcgga aaggctaatc gggcgctacc gccaggccta cgaacccaag       240
     cccctggtgg tgagcaagct atttccctac ccctggcgct tctcccgcaa gacgctgttt       300
     gccgcgctta aaaaaagcct gcagcgcctg cagatgcagc agctagatct gtacctgctg       360
     cactggccct ggaagccggt tccgctcgag cagtgggcgc tttcgctggc cgaagcctac       420
     gaacaggggc tgacccgggc ggtgggggtc tccaaccata acctccagca gcttgaacgc       480
     gtggctaagg tacttgatca gcaccgggtg ccgctggcgg tcaaccaggt ggagtaccac       540
     ctgctcgagc gcaaacctga acgaacgggc cttctacgcg ccatgcaggc cgagggtatc       600
     gtgctgatgg cctatagccc gctggctatg ggctggctaa ccggcaagta cggcctggac       660
     aaccccccac caggccgcta ccgggcccag cgctatgtca cccgcaaggc ccagattccc       720
     gcactgctcc aggctcttaa cgagatcgcc gaatcgctgg gggccacccc cgcccaggtg       780
     gccctgcgct ggtgcataca aaaaggcacc ctgcccattc cgggtgccaa aaacgcgtgc       840
     caggccgagg gaaacgcagg ggctttgcga atctgccttt ccgaggcgca gatggcccgg       900
     ctggatgcct tgagcggtgg ggaagggccg ggctag                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page