(data stored in ACNUC7421 zone)

EMBL: CP001743.PE488

CP001743.PE488       Location/Qualifiers
FT   CDS_pept        complement(480931..481833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0493"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; SPTR: A6N7U0 Probable
FT                   glucokinase; InterPro IPR000600; COGs: COG1940
FT                   Transcriptional regulator/sugar kinase; KEGG: mlo:mlr7234
FT                   glucose kinase; PFAM: ROK family; TIGRFAM: ROK family
FT                   protein (putative glucokinase)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27270"
FT                   /protein_id="ADD27270.1"
FT                   /translation="MSVVGIDLGGTKIMAGVFSEGVIKTKVTVPTPEEGGQAVIEAMAQ
FT                   AAKAAIEASGVAVQAIGLGTPGPLDFKRGRIKFAPNIANFTDFPIVERLEQATGYKVYM
FT                   ENDANAAALAEHKLGAAQGAESTLYMTVSTGVGGGFVWGNKVLRGVNGQGGEIGHITMQ
FT                   PGGPSCGCGLDGCLEALATGPAMERMALASFKREMNTRELFALFQQGDPRASRIVLQAA
FT                   SWVGIALASLVKCYDPEVVVLGGGVALNAGPAYLEEVQRSYQRYMENWITPPLHLAKLG
FT                   SEAGLLGAALTAAIEVGEL"
     atgagcgtag tgggaattga tctaggcgga accaagatca tggccggggt gttcagcgag        60
     ggcgtgatta agaccaaggt gaccgtaccc acgccagaag aaggcggcca ggccgtgatc       120
     gaggccatgg cccaggctgc caaggcggcc atcgaggcct cgggcgtggc ggtgcaggcc       180
     atcggcctgg gcacgccggg gcccctcgac ttcaagcggg gccggatcaa gtttgctccc       240
     aacatcgcca actttaccga tttccccatt gtggagcggc tcgagcaggc caccggctac       300
     aaggtctaca tggaaaacga cgccaacgcc gcggccctgg ccgagcacaa gctgggggcc       360
     gcccagggcg ccgaaagcac cctctacatg acggtctcga ccggggtagg gggcggcttt       420
     gtctggggca acaaggtgct gcgcggcgta aacgggcagg gaggcgagat cgggcacatc       480
     accatgcagc cgggcggccc ctcgtgcggc tgcggactgg atggctgcct cgaggccctg       540
     gccaccggcc cggccatgga gcgcatggcc ctggcctcct tcaagcgcga gatgaacacc       600
     cgcgagctgt tcgcgctgtt ccagcagggc gacccccggg ccagccgcat cgtgctgcag       660
     gccgcaagct gggtgggcat cgcgctggcc tcgctggtca agtgctacga ccccgaggtg       720
     gtggtgctgg ggggtggggt ggccctcaac gcagggccgg cctacctcga ggaggtgcag       780
     cgcagctacc agcgctacat ggagaactgg atcaccccac ccctccacct ggccaagctg       840
     ggcagcgagg ccgggctgct gggggcggcc ctgaccgcgg ccatcgaggt gggtgagctc       900
     tag                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page