(data stored in ACNUC7421 zone)

EMBL: CP001743.PE49

CP001743.PE49        Location/Qualifiers
FT   CDS_pept        42157..42591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0050"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; SPTR: A7BSJ7
FT                   Putative uncharacterized protein; InterPro IPR002716; COGs:
FT                   COG5573 nucleic-acid-binding protein contains PIN domain;
FT                   KEGG: tgr:Tgr7_3220 PilT domain-containing protein; PFAM:
FT                   PIN domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26831"
FT                   /protein_id="ADD26831.1"
FT                   /translation="MKYRYLVDTNLLIYPLDARDPRKQQQAANVLLELVQEGRAALPVQ
FT                   ALSEFASVALRRLEPPLSPQQVGLEVERLMQAFPVLPLTAPVVLEALRGVTQHRLSYYD
FT                   AQVWATARLYQVPLVLSEDFPTGAVLEGVRFLNPLEDALG"
     gtgaaatatc gctatctggt ggataccaac ctcctgatct accccctgga tgctcgagac        60
     ccccgtaaac agcagcaggc tgccaatgtg ctcctcgagc tagtccagga gggtcgggca       120
     gccctaccgg tgcaggccct gagcgagttt gccagcgtag ccctgcgccg cctcgagccg       180
     cccctgagcc cgcaacaggt ggggctcgag gtcgagcggc tgatgcaggc ctttccggtg       240
     cttcccctca ccgcgccggt ggtgctggag gccctgcggg gcgtaaccca gcaccggctc       300
     agctactacg acgcccaggt ctgggccacg gcccgactct accaggtgcc cctggtgctt       360
     tcggaggact ttcccacggg ggcggtgctg gagggggtgc ggtttcttaa tccgctggag       420
     gatgcgcttg gctaa                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page