(data stored in ACNUC7421 zone)

EMBL: CP001743.PE490

CP001743.PE490       Location/Qualifiers
FT   CDS_pept        complement(484775..485491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0497"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; InterPro
FT                   IPR001387; KEGG: oca:OCAR_4515 transcriptional regulator of
FT                   XRE family; SMART: helix-turn-helix domain protein; PFAM:
FT                   Helix-turn-helix"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27272"
FT                   /protein_id="ADD27272.1"
FT                   /translation="MPKKSFRTASLTPENVTPDWGRLLQTRREKLGLSREALALAAGVS
FT                   PSLIAKLEQGNHDLRDVSVGRLHALLRTLHLPSIDFLLGEGPTEEFTPSAPGITPLPYY
FT                   SSLTLACAGEEASTRSHFDTRLLPTRPSYTNFFLAILEQDVLRSEDLSLVEGSVLVVER
FT                   KPARERGIALLGFVEEIRRPLLYRLPPEPRLVRPVSGMGAVYWLLPDGSLQPPSGKKAA
FT                   MYPVPVGVIHGEFRHV"
     atgcctaaga aaagcttccg tactgcctcc cttacccctg aaaacgtcac acctgactgg        60
     gggcgactat tgcagaccag gcgagaaaag ctgggcctct ctcgtgaggc gttggccctg       120
     gctgctggtg tgtctccttc cctgatcgcc aaactcgagc agggcaatca cgacctcagg       180
     gacgtgagcg tgggccgttt gcacgcgttg ttgcgcacgc ttcacctccc ctccatagac       240
     tttttgttgg gggagggccc gaccgaggag ttcacccctt ccgcccccgg catcaccccg       300
     ctgccctact actcatcgct gaccctggcc tgtgctgggg aggaagcgtc cacgcgcagc       360
     catttcgaca cccgattgct tcccacccgg cccagctaca ccaacttctt cctggccata       420
     ctggagcagg acgtacttcg atctgaggat ctcagcctgg tcgagggctc ggtgctggtg       480
     gtggagcgga aacccgcccg ggagagaggc atcgccctgc tcggtttcgt cgaggaaatc       540
     cgacgacccc tgctgtaccg cctacccccg gagccccggc tggtgcggcc agtcagcggg       600
     atgggggcgg tgtactggct cctgccggac ggctctctcc agcccccctc cggtaagaaa       660
     gccgctatgt accctgtccc ggtgggtgtc atccacgggg agttccgtca cgtatga          717
//

If you have problems or comments...

PBIL Back to PBIL home page