(data stored in ACNUC7421 zone)

EMBL: CP001743.PE492

CP001743.PE492       Location/Qualifiers
FT   CDS_pept        485893..486333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27274"
FT                   /protein_id="ADD27274.1"
FT                   /translation="MRRAHQNTMQMERDLFLLIPRHKGLALSLPAGRITELLRFAQGML
FT                   ARLPDTRPAPDIAVELEGMGMMLHPLALLPDPIRELLEMTGRARCVCQALGIEMGGRLL
FT                   VSVGLAWLEVQVWRGESLEVLCHELEEETDDEGRPDPVHRGR"
     gtgcgcaggg cgcaccagaa cactatgcaa atggagagag acctgttttt gctgataccc        60
     cgccacaagg gtttggcgtt gagccttcct gcgggcagga tcacggaact gctgcgcttt       120
     gctcagggga tgttggcacg actcccggac accagacctg cgccggatat cgccgtcgaa       180
     ctggaaggta tggggatgat gctgcacccg ctggccctgc tccctgaccc gatccgggag       240
     ttgctggaga tgaccggcag ggcccgctgt gtctgtcagg cgttgggcat tgaaatgggc       300
     gggcggctac tggtgtctgt ggggctggcg tggcttgagg ttcaggtctg gcgcggagag       360
     agcctggagg tgctctgcca cgagctggag gaagaaaccg atgacgaagg acgccctgac       420
     ccagtccatc gaggacgttg a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page