(data stored in ACNUC7421 zone)

EMBL: CP001743.PE493

CP001743.PE493       Location/Qualifiers
FT   CDS_pept        486347..487234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0500"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vvu:VV1_0072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27275"
FT                   /protein_id="ADD27275.1"
FT                   /translation="MAELWPESGARPGKAGICRAVWRGDTHPSLSLFQARGVWFWKDHA
FT                   TGESGNAFHLLLKAGMSKEAAAALLKARAGSGGGAVTHEASIKCRASPRPVRGLTPTER
FT                   RALEAAQQRLDEEAIRGRGITLEQARRVGLGKSRQGDLVIPILGPTGEVQAIKARLREP
FT                   REGFRYRYLTPERGAPAWYSPGFGQDAGRPVIVMEGELNAITSWFALEGRADLLGIPGV
FT                   EGRVPWEGLTGRRVYLYADGDPGGRRAIERWKEEGQAGGVAMFVLEPLEGGLDACEYAA
FT                   RWGQQGLAGQLLQE"
     gtggccgaac tctggccgga gtcgggggcc aggccaggga aagcgggcat ctgtcgggcg        60
     gtgtggcggg gggacacgca cccctcgctt tcgctttttc aggcgcgggg ggtgtggttc       120
     tggaaagacc acgccaccgg ggagagcggc aatgcctttc acctgcttct caaggcgggg       180
     atgagcaagg aggcggcggc ggcattgctc aaggcccggg ccggtagcgg cggcggggcc       240
     gtgacccatg aggccagcat caaatgccga gcaagccccc gccctgtgcg gggccttacc       300
     ccgacggaga ggagggccct cgaggcggcc cagcagcgcc tcgacgagga ggccatacgc       360
     ggacggggca tcaccctcga gcaggcccgg cgggtggggc tgggcaagag ccgtcagggt       420
     gacctggtga tccccatcct ggggcccacc ggggaggtgc aggccatcaa ggccaggctg       480
     cgcgagccca gggagggttt ccgctaccgc tacctgaccc ccgagcgagg ggcgcccgcc       540
     tggtactccc ccggtttcgg gcaggatgca ggccgacccg tgatcgtgat ggagggggag       600
     ctcaacgcca tcaccagttg gtttgccctg gagggtcggg ccgacctgct gggcattccc       660
     ggcgtggagg gccgggtgcc ctgggagggc ctgacaggcc gccgggtcta cctctatgcc       720
     gacggagacc ccggcggacg cagggcgata gagcgctgga aggaggaagg gcaggctggg       780
     ggagttgcga tgtttgtcct ggaacccctg gagggcggac tcgacgcctg tgaatacgcc       840
     gcccggtggg ggcagcaggg tttggccggg caactgttgc aggaataa                    888
//

If you have problems or comments...

PBIL Back to PBIL home page