(data stored in ACNUC7421 zone)

EMBL: CP001743.PE494

CP001743.PE494       Location/Qualifiers
FT   CDS_pept        487279..489222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0501"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: asa:ASA_3672 superfamily II helicase; SPTR:
FT                   A3V916 DNA primase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27276"
FT                   /protein_id="ADD27276.1"
FT                   /translation="MVKSIPPVHQDFISPVELEEVLPGHPRYRIQQGRIEMARLEGRGE
FT                   HRTVVYVPLCNFACRIRREVRYTDGVQDELLFELEGSTAAGPLPSARVRSSEFAAMHWP
FT                   VREWGARAIVTPGHGVKDHLRAAIQHLSTPEQATVYAHTGWVRQGGDWVYLHAGGGIGP
FT                   EGSVEGLEVDLPPELSGFALPQPPTGEAEPEAHRRLLAMLEAGPRRVTWPLLLYALGAP
FT                   INHPLGSLYVAGLTGARKTSLALLVQALWGHTAPHPPTNWEGTANALEALAFAAKDALL
FT                   LIDDYAPTGHEGKQKELQGKAARILRNQGNATGRARMRSDGRMQPDRAPRGSLLVTGED
FT                   LPPGHSVRARCLILELTPGEVNLEALTRLQNQAAGFPLALAAWVRWLAGRLEGVRQQVR
FT                   LRTGELRSCYPAAHGRTTDALARLQAVWEIVRAYWLEVGVISPAEAERFTREVEAVLHE
FT                   VGEAQQGYQSDMNPVERFIPLVLGLLSSGRAHLGNRHDAQTPPAEPERWGWQARADGWV
FT                   PQGPLVGWVDAQGIYLEPTAAYAALNRLAAESGEPLPTPRTLWKRLGERGVIRSQQRGG
FT                   RVRYGVGVRIQGTTRDVVQIPGGVLAKTPNSPNMGQNTVLDDTKDVGRKPAVGSSVCPN
FT                   GEGEVGAYEVEL"
     atggtcaaga gtataccacc cgtacatcaa gactttataa gcccggtaga gcttgaggag        60
     gttctgcccg gccatccccg ctaccgcatc cagcaagggc gcattgagat ggcccggctg       120
     gaagggcggg gtgagcatcg gactgttgtc tacgtgccgc tttgcaactt tgcctgtcgc       180
     atccggcggg aggtgcgcta cacggatggg gtgcaggacg agctgctgtt cgagctcgag       240
     ggctccaccg cagccggccc ccttccgtcc gcccgggtgc gctcgagcga gtttgctgcg       300
     atgcactggc cggtgcggga gtggggggcc cgggccatcg tgacgccggg acatggggtc       360
     aaagaccatc ttcgcgccgc catccaacac ctgagcaccc ctgagcaggc cacggtctac       420
     gcccacaccg gctgggttcg gcagggcggg gattgggtgt acctgcacgc cgggggcggc       480
     atcgggccgg agggcagcgt ggagggcctc gaggtggatc tcccccccga actgagcggc       540
     ttcgccctgc cccaaccgcc caccggcgag gccgaaccgg aggcgcaccg gcggctgctg       600
     gcaatgctgg aggcaggccc ccggcgggtc acctggcccc ttttgctcta tgccctggga       660
     gcacccatca accacccgct gggcagcctg tacgttgccg ggctgaccgg ggcccgcaag       720
     accagcctgg ccctgctggt gcaggcgttg tgggggcaca ctgccccgca cccgccgacg       780
     aactgggagg gcacggcgaa cgccctggag gccctggcct tcgcggccaa ggatgccctg       840
     ctgctgattg acgactacgc ccccaccgga catgagggca agcagaagga gctccagggt       900
     aaggccgccc ggattctgcg caaccagggc aacgccacgg ggcgggcgcg gatgcgctcg       960
     gacggacgga tgcagcccga ccgggccccc cggggcagcc tgctggtcac cggcgaggat      1020
     ctgccccccg gccacagcgt gcgggcgcgg tgcctgatcc tcgagctaac cccgggcgag      1080
     gtgaacctgg aggcgctcac ccggctgcaa aaccaggcgg cggggtttcc cctggccctg      1140
     gccgcctggg tgcgctggct ggccgggcgg ctggaggggg tgcggcagca ggtgcggctt      1200
     cgcaccggcg agctgcgctc atgctatcca gccgcccacg gacgcaccac cgacgccctg      1260
     gcccggcttc aggcagtgtg ggagatcgtg cgggcttact ggctcgaggt gggggtcatc      1320
     tccccggcgg aggcggagcg gttcacgcgg gaggtggagg ccgtcctgca tgaggtgggg      1380
     gaggcgcagc agggctacca gagcgacatg aacccggtgg agcgcttcat cccgctggtg      1440
     ctggggctcc tgagcagcgg gcgggcccac ctgggcaacc gccatgacgc ccagaccccc      1500
     cctgccgaac ccgagcggtg gggctggcag gcccgggcgg acgggtgggt gccccagggg      1560
     ccgctggtgg gctgggtgga tgcccagggc atatacctgg aacccaccgc cgcctacgcc      1620
     gcgctgaacc gcctggcggc ggagagcggg gagccgctcc ctaccccccg caccctgtgg      1680
     aagcggttgg gcgagcgggg ggtgatccgc tcgcaacagc ggggtgggcg ggtgcgctac      1740
     ggggtggggg tgcggattca gggcacgacc cgtgacgtgg tgcaaattcc agggggtgtc      1800
     ctcgccaaaa ctcccaacag tcccaacatg gggcaaaata ctgtcctgga cgacacaaaa      1860
     gacgttggga gaaaaccggc tgttgggagt tcagtttgtc ccaacggcga gggggaggtg      1920
     ggggcgtatg aggtggaact ctag                                             1944
//

If you have problems or comments...

PBIL Back to PBIL home page