(data stored in ACNUC7421 zone)

EMBL: CP001743.PE495

CP001743.PE495       Location/Qualifiers
FT   CDS_pept        489515..489871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0502"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27277"
FT                   /protein_id="ADD27277.1"
FT                   /translation="MSPWGVLLRMVPEVTAKLKGLGCRRLRWLVDGEVVYWALLVPEEA
FT                   DLEAHARFPGMPQQSLEGWLRELLERFEAGWPQARVVEILGVWPDRLERVVRVFPKGPG
FT                   VSLSEECYADPSSG"
     atgagtcctt ggggggtgct gctacggatg gtgccggagg tgacggcgaa gctaaagggg        60
     ctggggtgtc gcaggctgcg gtggttggtg gacggggagg tggtctactg ggcgctgctg       120
     gtgccggagg aggccgacct ggaggcccac gcccggtttc cggggatgcc gcagcaaagc       180
     ctggaggggt ggttgaggga gttgctcgag cgcttcgagg cgggctggcc ccaggcccgg       240
     gtggtggaaa tcctgggggt ctggcctgac cggttggagc gggtggtgcg ggtattccca       300
     aaggggccgg gggtttccct ttccgaggaa tgctatgctg atccgtcctc gggctaa          357
//

If you have problems or comments...

PBIL Back to PBIL home page