(data stored in ACNUC7421 zone)

EMBL: CP001743.PE496

CP001743.PE496       Location/Qualifiers
FT   CDS_pept        489849..490205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27278"
FT                   /protein_id="ADD27278.1"
FT                   /translation="MLIRPRAKIVALSLRMPPGAIVVRACHDAELFLSRPVEAGGEVWR
FT                   EVRVREREGFRTLYELVAEGRFEERLLKSRVQFEKIQEGSRVYYVWRLGRPRGVSDKEV
FT                   DGLDLEAERDDWRA"
     atgctgatcc gtcctcgggc taaaatcgtg gcgctctcgc tcaggatgcc gccaggggct        60
     atcgtggtaa gggcttgcca cgatgccgag cttttcctct cgaggcccgt ggaggccggg       120
     ggggaggtgt ggcgggaggt gcgggtgcgg gagcgggagg gctttcgtac cctctacgag       180
     cttgtggccg agggcaggtt cgaggagcgg ctgttgaaga gccgggtgca gttcgagaaa       240
     atacaagaag gttccagggt ctactatgtg tggcggctgg gccgaccgcg tggggtgagc       300
     gataaggagg tggacgggct tgatcttgaa gctgaacggg atgattggcg agcgtga          357
//

If you have problems or comments...

PBIL Back to PBIL home page