(data stored in ACNUC7421 zone)

EMBL: CP001743.PE498

CP001743.PE498       Location/Qualifiers
FT   CDS_pept        490539..491357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0505"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpt:Rpal_0183 2-oxoglutarate dehydrogenase, E2
FT                   subunit, dihydrolipoamide succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27280"
FT                   /protein_id="ADD27280.1"
FT                   /translation="MKVISYCKQLALVFMLLTPLAMGQSVLKTYYADDLTRVPGVIEVS
FT                   PGFTTVLDFWDTVSTLASAKGELLRVESAGPRILVSATQKAGQTDLVVEVAGRTLLFTL
FT                   KIGPGVGPRRYVIELSRRSSVSAPASAYVPPASPAPSSPAPQAAQPPQSAPLNPEAVRF
FT                   TTTAQVPSDGKGTVTIFFTLENRGNRTLAADPGRLVITQGGNRLSYSLKREPLKTLVNP
FT                   GEALSGLITLEGARAGEIGLEWGLVEIGSGRQFALKRSVMAGTRIELEGR"
     atgaaggtaa taagttattg caaacaactg gccctggtgt tcatgctgct cacgccgctg        60
     gcgatgggcc agtcggtgct caagacctac tacgccgatg acctcacgcg ggttccgggg       120
     gtgatcgagg tcagccccgg ctttaccacg gtgctggact tctgggacac ggtgagcacc       180
     ctggcctcgg ccaagggcga gcttctgcgg gtggagagcg ccgggccgcg catcctggtt       240
     tcggccaccc agaaggccgg gcagaccgac ctggtggtgg aggtggccgg gcgcaccctg       300
     cttttcaccc tcaagatcgg gccgggggtg gggccccggc gctatgtgat cgagctttcc       360
     cggcgcagca gcgtgagcgc accggcgagc gcctacgtcc caccggcgag cccggccccg       420
     agcagcccgg ccccgcaggc cgcacagccg ccgcagagcg cacctctgaa cccggaggcg       480
     gtgcggttta ccaccaccgc ccaggtgccc tcggatggga agggcacggt gacgatcttc       540
     ttcaccctgg agaaccgggg aaaccgcacg ctggcggcgg accccggaag gctggtgatc       600
     acccagggcg gcaaccggct ctcctacagc ctcaagcgag agcctctgaa gaccctggtc       660
     aaccccggtg aggccctttc gggcctcatc acgctggagg gggcccgggc cggggagatc       720
     gggctggagt gggggttggt ggagatcggc agcgggcggc aattcgccct caagcgctcg       780
     gtgatggcgg gtacgcggat cgagctcgag gggcgatga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page