(data stored in ACNUC7421 zone)

EMBL: CP001743.PE50

CP001743.PE50        Location/Qualifiers
FT   CDS_pept        complement(42588..43694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0051"
FT                   /product="peptidase C45 acyl-coenzyme A:6-aminopenicillanic
FT                   acid acyl-transferase"
FT                   /note="PFAM: peptidase C45 acyl-coenzyme
FT                   A:6-aminopenicillanic acid acyl-transferase; InterPro
FT                   IPR005079; KEGG: pol:Bpro_1442 peptidase C45, acyl-coenzyme
FT                   A:6-aminopenicillanic acid acyl-transferase; SPTR: A5DPG6
FT                   Putative uncharacterized protein; PFAM: Acyl-coenzyme
FT                   A:6-aminopenicillanic acid acyl-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26832"
FT                   /protein_id="ADD26832.1"
FT                   /translation="MAEGMLPYLQLSGPPYEQGHQQGTAWAGQIAHNLELYFHRFEVEC
FT                   KLSPSEARERGARYFQAIREQNPAYAQGLEGIAAGSGQPLVDIATLNVRYEIVYHQFAQ
FT                   DTPPVYPAREAPNGCTAFALMPAHSADGHLWLGQNWDWMEGVQGALQHITEPDGTRILA
FT                   FTEAGIFGGKIGLNSHGLGLCINGLVSVGDNWAGLGKPFHLRTYEALRQKTLEAAQAVV
FT                   LEEPRTASGNFLLGQGAQAVDIEVSPQGVCRWQDERQLVHANHYLAPERYGIEVPPIEW
FT                   LDRSHHRAERLALRLGEVEKPGLEDLKAALSDRDGAPYAVCRTASPEEYALGEPYRTIV
FT                   SVIMNLGTKELWISDGPPHENPYVHYQV"
     atggcagagg gtatgctacc ttatctgcaa ctctccggcc cgccctacga gcaaggccat        60
     cagcaaggaa ccgcctgggc cgggcaaatc gcccacaacc tcgagctcta ctttcaccgc       120
     ttcgaggtgg agtgcaagct ctcccccagc gaggcccgcg aacggggggc ccgctacttc       180
     caggccatcc gggagcaaaa cccagcctac gcccagggcc tcgagggcat cgccgcgggg       240
     tcggggcaac ccctggtcga tatcgccacc ctcaacgtgc gctacgagat cgtctatcat       300
     cagttcgccc aggacacccc cccggtctac ccggcccgcg aggcccccaa cggctgcacc       360
     gcctttgccc tgatgcccgc ccacagcgcc gacggccacc tgtggctggg ccagaactgg       420
     gactggatgg aaggggtaca gggggccttg cagcacatca ccgagcccga cggaacccgc       480
     atcctggcct ttaccgaggc cggtattttt ggtggcaaga tcgggctcaa ctcccacggt       540
     ctgggcctgt gcatcaacgg gctggtctcg gtgggcgaca actgggccgg gctgggcaaa       600
     cccttccacc tgcgcaccta cgaggcgttg cggcaaaaaa ccctggaggc cgcccaggcc       660
     gtggtgttgg aagaaccccg caccgcctcg ggcaatttcc tgctggggca gggggcccag       720
     gccgtggata tcgaggtctc cccccagggc gtctgccgct ggcaggacga gcgccagctg       780
     gtgcacgcca accactacct ggcccccgag cgctacggca tcgaggtgcc gcccatcgag       840
     tggctcgacc gctcgcacca ccgggccgag cgcctggccc tgcggctggg cgaggtggaa       900
     aaacccggcc tggaagacct caaagcggcc ctatccgacc gggatggcgc cccttatgcg       960
     gtctgccgca ccgccagccc ggaggaatac gcgctgggcg agccctaccg caccatcgtt      1020
     tcggtgatta tgaacctggg aacaaaggag ctctggatat ccgacgggcc cccgcacgag      1080
     aacccctacg tgcactacca ggtttag                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page