(data stored in ACNUC7421 zone)

EMBL: CP001743.PE501

CP001743.PE501       Location/Qualifiers
FT   CDS_pept        492439..492729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27283"
FT                   /protein_id="ADD27283.1"
FT                   /translation="MQVADKVVLVTLYPDRPMSGAEAEEWAAGRLQAQLPLEAFEDGKP
FT                   LPPVAVVQEGQTVGFLEGARLLTDTHAGLRLVGVAGRWEGQNVSGMINLDG"
     atgcaagttg cggataaggt ggtgctggta accctgtacc ctgaccggcc catgagcggg        60
     gccgaggccg aggagtgggc ggcgggcagg ctgcaagcgc agcttccgct cgaggcgttt       120
     gaggatggga agcccctgcc gccggtggcg gtggtgcagg agggacagac ggtaggcttc       180
     ctggaagggg caaggctcct gacggatacc cacgcagggt tgcggctggt aggggtcgcg       240
     ggccggtggg agggacagaa cgtgagcggg atgatcaacc tggatggcta g                291
//

If you have problems or comments...

PBIL Back to PBIL home page