(data stored in ACNUC7421 zone)

EMBL: CP001743.PE502

CP001743.PE502       Location/Qualifiers
FT   CDS_pept        492722..493393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27284"
FT                   /protein_id="ADD27284.1"
FT                   /translation="MARGELDQLHNHALNEGVKMMGERYGLEAADGAIIRPTLEAAMEV
FT                   LPLPHQRFVQEHLDYYRRRFSVMEKEGAEAVLVVWSLEEPLVRMMGLGQMPDLVRLPWV
FT                   GSRPLRKDFRDAPVLTRQEALRQIAHILQAEGFTPQEEPVLLPPESDQLAVEVAARLRL
FT                   VAEGRSLEDTARLLVERNRARWEQEGEAPQAVAVVDVGGPLPVMLAFDDPRPLVWGGAV
FT                   A"
     atggctagag gggagctaga ccagcttcac aaccacgccc tcaacgaggg ggtgaagatg        60
     atgggtgagc ggtacggcct cgaggcggcg gacggggcca tcatccgccc caccctcgag       120
     gcggcgatgg aggtgctgcc cctaccgcac caacgtttcg tacaggagca cctggactac       180
     taccggcggc gtttttcggt catggaaaag gaaggggcag aggcggtgct ggtggtgtgg       240
     agcctggaag agccgctggt tcggatgatg ggcctgggcc agatgcctga cctcgtgcgg       300
     ctcccctggg tcgggagccg gcccctgcgg aaagacttcc gggatgcgcc ggtgctcacg       360
     cggcaggagg ccctgcgaca gattgcccat atcctgcaag cagagggctt taccccacag       420
     gaggagccgg tgctgctgcc ccctgaatcc gaccaattgg cagtcgaggt agcggcccgg       480
     ctgcggctgg tggccgaggg gcggagcctg gaagacaccg cccggctgct ggtggagcgt       540
     aaccgggccc gctgggagca ggagggggag gccccgcagg cggtggcagt ggtggacgtg       600
     ggaggccccc tcccggtgat gctggccttt gacgatcccc gccccctcgt gtggggaggg       660
     gcggtggcat ag                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page