(data stored in ACNUC7421 zone)

EMBL: CP001743.PE503

CP001743.PE503       Location/Qualifiers
FT   CDS_pept        493561..494199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27285"
FT                   /protein_id="ADD27285.1"
FT                   /translation="MRVAVFPSFLTGDQIEAWLARGVTAELDRATVSDPSPRPVRLPVY
FT                   KGEEAGGVLEGRLVGLEEGVLVVEGTYEGLPVRVAVSREEIARQFDLEDTPLYLWRPLQ
FT                   LPEAAWAAWQADLARLGLLDRAGLLGAAKDGGPLCRAEPTPENAWVFWLAAWRFGSRVG
FT                   LDLGMRQEPFERAFAALKERLPELPEALLERSREALGWGKEELRELRAK"
     gtgcgagtgg cagtgtttcc cagcttcctg acaggtgacc agattgaagc atggctcgct        60
     cgaggcgtca cggcggaact tgaccgggcc actgtgagcg acccttctcc caggccggtg       120
     aggctgcccg tttataaagg cgaggaggcc gggggtgttc tggaagggcg gctggtaggt       180
     cttgaagaag gtgtcctggt tgtcgaagga acctatgaag ggctgccggt gcgggtggcg       240
     gtatcccggg aggagatagc ccgccagttc gacctggagg ataccccact ctacctgtgg       300
     cggcccctgc aacttcccga ggcggcgtgg gcagcgtggc aggccgacct tgcgcgactt       360
     ggcctgctgg acagggccgg gcttctgggg gctgccaaag atggcggccc gctctgccgc       420
     gccgaaccca ccccggagaa cgcctgggtc ttctggctgg cagcctggcg gtttggaagc       480
     cgggtagggc tcgacctggg aatgcggcag gaacccttcg agcgggcttt tgccgcactc       540
     aaagaacgcc tgccggagct acccgaagcg ctgctcgagc gcagccggga ggctctgggc       600
     tgggggaagg aagagctgcg ggagcttcgg gcaaaatag                              639
//

If you have problems or comments...

PBIL Back to PBIL home page