(data stored in ACNUC7421 zone)

EMBL: CP001743.PE504

CP001743.PE504       Location/Qualifiers
FT   CDS_pept        494216..494455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27286"
FT                   /protein_id="ADD27286.1"
FT                   /translation="MRRDGERLILITSLRAYSTRSLKNTLKRMGWYSRSKQGEAEWVRV
FT                   YHPYPKRFDRMEREGGLEVRPVSEILPPEVNGEE"
     atgcgccggg acggagaacg gttgatcctg ataacgagct tgcgagcgta cagcacccgc        60
     agcctcaaga acaccctcaa gcgcatggga tggtacagcc gaagcaagca gggtgaggcg       120
     gaatgggtgc gggtctacca cccctacccg aagcggtttg accggatgga gcgggagggg       180
     ggtctggaag taagaccggt gagcgaaatc ttacccccgg aagttaatgg tgaggagtga       240
//

If you have problems or comments...

PBIL Back to PBIL home page