(data stored in ACNUC7421 zone)

EMBL: CP001743.PE505

CP001743.PE505       Location/Qualifiers
FT   CDS_pept        complement(494528..494791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27287"
FT                   /protein_id="ADD27287.1"
FT                   /translation="MRLVILAEEPPAELRAQLTFFEVCTEEKLLSLTSLYPVKAAPRVL
FT                   PFLRLCGIEASEVGKSVRSGDLVAWPLPERPGRNSRWMLMLA"
     atgcgccttg tcatccttgc cgaagagccc ccggcggagc tgcgggctca gttaaccttc        60
     tttgaggtat gcaccgaaga aaaacttctg agcctcacca gcctctaccc ggtcaaggca       120
     gcgccccggg tcctgccctt cctccgcctt tgtggcatcg aggcgagtga ggtggggaag       180
     tctgtccgct caggcgacct cgttgcctgg cccctgccag agcgccctgg ccggaactct       240
     cgctggatgc tgatgctggc ctag                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page