(data stored in ACNUC7421 zone)

EMBL: CP001743.PE506

CP001743.PE506       Location/Qualifiers
FT   CDS_pept        494934..495611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0513"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27288"
FT                   /protein_id="ADD27288.1"
FT                   /translation="MRAELTDLFDRSLSSGVRMVAERYGLEAEAADGALTRPTLEAALE
FT                   AVPPPHQRFMQEHLDYYRRRLSVLEKERAEAALVVWSLEEPLVWLTGIVDMLEVERLPW
FT                   VRGRPLKEGFRDAPPLLTPGETLRQVVHILKAEGYTPREEPRLLPPEPHRLVEVVTPRL
FT                   RVIAQGRTLEESARLVVERTMTRWKEEGECPQAVAVVDVGGPIPVMLAFDDPRPLVWAE
FT                   AGA"
     atgcgagcag aattaactga cctctttgat cgcagcctgt ccagcggtgt gcggatggtg        60
     gccgagcggt atgggctcga ggcggaagca gcagacggag ccctcacccg gcccacgctg       120
     gaagctgccc tggaagcagt ccccccaccg caccaacgct ttatgcagga acatctggac       180
     tattaccggc ggcgtctatc ggtactggag aaggagaggg cggaagcggc gctggtggtg       240
     tggagcctgg aagagccgct ggtctggctc accggtatag tcgatatgct cgaagtggag       300
     cgcctgccgt gggtgcgcgg caggcccttg aaggagggct tcagggatgc accccccctg       360
     ctcacgccgg gcgagaccct gcggcaggtg gtgcacatac tgaaagccga gggctatacc       420
     ccgcgagagg aaccgaggct gctcccccca gaaccccatc gcctggtgga ggtggtgacg       480
     ccccggctgc gggtcattgc ccaggggcga accctcgagg agagcgcccg gctggtggtg       540
     gagcggacca tgacccggtg gaaggaggag ggggagtgcc cccaggcggt agcggtcgtg       600
     gacgtgggcg gcccgattcc ggtgatgctg gcctttgacg atccccgccc cctggtgtgg       660
     gcggaggcgg gggcctga                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page