(data stored in ACNUC7421 zone)

EMBL: CP001743.PE507

CP001743.PE507       Location/Qualifiers
FT   CDS_pept        complement(495660..496244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27289"
FT                   /protein_id="ADD27289.1"
FT                   /translation="MFQVKTPLRGSERREILERIRTTIRCDLALSEGQLLRHYGVVPSE
FT                   KEAHEMGLFVVRAVLNPSHHANRLMEVRFYTPYLWVSRLGPPLLRHLAGVGEMRHILGA
FT                   AVGDWRTDTHRIHYREQPDAYWYSRLGPFAIEYDAGSYSLGLLQRKVQTFALRFVGQYW
FT                   GAPTERKAASLRERLAPFGLDGRFVLAAPWW"
     ttgttccagg tcaagacgcc gctacgggga agtgagcgcc gggagatcct cgagcgcatc        60
     cgtaccacca tacgctgcga cctggccctc agtgagggcc agttgttgcg tcactacggg       120
     gtggttccct cggagaagga ggcccacgag atgggcctct tcgtagtgcg ggcggtgctg       180
     aacccctcgc accacgccaa ccggcttatg gaggtacgct tctacacccc ttacctctgg       240
     gtcagccgcc tggggccgcc cctgctgcgc cacctggccg gggtggggga gatgcggcac       300
     atcctggggg ctgcggtggg cgactggcgt accgacaccc accgcatcca ctaccgtgag       360
     caacccgatg cctactggta cagcaggctg ggcccctttg cgattgaata cgacgcggga       420
     agctactccc tgggcctgct ccagcgcaag gtgcagacct ttgccctgcg cttcgtgggg       480
     cagtattggg gcgctcccac ggaaaggaag gccgccagcc tgcgggagag gctggccccc       540
     ttcgggctgg atggacggtt cgtgctggct gcgccctggt ggtag                       585
//

If you have problems or comments...

PBIL Back to PBIL home page