(data stored in ACNUC7421 zone)

EMBL: CP001743.PE509

CP001743.PE509       Location/Qualifiers
FT   CDS_pept        498013..498354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0516"
FT                   /product="Conjugal transfer protein TrbC"
FT                   /note="InterPro IPR007039; PFAM: Conjugal transfer protein
FT                   TrbC; PFAM: TrbC/VIRB2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27291"
FT                   /protein_id="ADD27291.1"
FT                   /translation="MHKAAILAKRLAALPEVRGLLMGLVLVGMGNVAHAQAEQAFNNLT
FT                   IAICNIYNALRGPFGLALVVIMFAIGGISLMIGGKKAVPIMIGAAIGGVILAAAPSFAR
FT                   IFVSGTGCA"
     atgcacaaag cggcgatttt ggctaaacgg ttggcggctc tgccggaggt tcgcgggttg        60
     ctgatggggt tggtgctggt ggggatgggc aacgtggccc acgcccaggc tgaacaagcg       120
     ttcaacaacc tgaccatcgc catctgcaac atctacaatg cgctgcgcgg cccttttggc       180
     ctggcgctgg tggtcatcat gttcgccatc ggcggcatca gcttgatgat cggcgggaaa       240
     aaggccgtgc cgatcatgat cggggcggct atcggcgggg tgatcctggc ggcggcccct       300
     tcgtttgcgc ggattttcgt ttccggtacg ggctgcgcct ga                          342
//

If you have problems or comments...

PBIL Back to PBIL home page