(data stored in ACNUC7421 zone)

EMBL: CP001743.PE510

CP001743.PE510       Location/Qualifiers
FT   CDS_pept        498354..498662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27292"
FT                   /protein_id="ADD27292.1"
FT                   /translation="MRRRVYRLYQPITIVGLELWQLPVIGLGFVIGLRLMEGVHPAAGL
FT                   LSGALTGYLALTAAEKLRERYPGASLLHEALWLTQSDRYTPGKDQETTPLLIRNDHE"
     atgcgtcgtc gggtgtaccg cctctaccag cccatcacca tcgtggggct ggaactctgg        60
     caactcccgg tcatcgggct ggggttcgtg atcggcctgc gcctcatgga aggggtgcat       120
     ccggcggcag ggctcctctc gggggccctg accggctacc tggcgctgac agcggcggag       180
     aagctgcggg agcgctaccc gggtgcttcg cttttgcatg aggcgctgtg gctcacgcag       240
     agcgaccgct atacgccggg aaaggatcag gagaccacac cgctgttgat tcgcaatgac       300
     cacgaatag                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page