(data stored in ACNUC7421 zone)

EMBL: CP001743.PE515

CP001743.PE515       Location/Qualifiers
FT   CDS_pept        504255..506540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0522"
FT                   /product="Type IV secretory pathway VirD4 protein"
FT                   /note="SPTR: A4F5I0 Putative uncharacterized protein; COGs:
FT                   COG3505 Type IV secretory pathway VirD4 protein; KEGG:
FT                   sit:TM1040_3794 TraG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27297"
FT                   /protein_id="ADD27297.1"
FT                   /translation="MSVTRRQSLLEVPTSQKLLRFLGGLVMLSTLALAFGVGWQAALEV
FT                   AQGMLRAGWGAALKASSPAELILRCYGDLTGNCTEVMNGLWQKALPLDTLRMVVAGGFV
FT                   LGMIPFLIRPHRPRKLPGQGRWASASDLKGYLGEGTGWYGLFEGKPLRVPSMERRTGTL
FT                   VVGKPGGGKTTGYYQPNLLLDARDGWSAIVFDLKWPDEGGLMEAIRYYSHFGRAVYAYT
FT                   PFAPGSARIALLEGAENPQEASNIADIIVPRLADGGAEFYANLERMLLAGLIWVEGQEG
FT                   RYSLRHILELLRQGKEEIKAYAEVRPHLKDRIGAVMQTREDIIAGVVAGLAGRLALFEN
FT                   DHLDRSSLPGAGAVPWPRLFSEPSLLYIGIPQEHLEGGKATALLWLVKRILDREIHRAA
FT                   ARNGGTLKALTSVYLDEFTAFGKLPGIEDNLKTMRSRGAAFHVSVQNLANGRSVYGRDV
FT                   WESIQGTFGQQVYLLERLSEEDRKWLARTLGYETVVGYSRSASKMGFLSGSEGEGEREE
FT                   ARFLLSAEEMREVKKGETVVILDGKPPVRTYLGGMWEKKHPLHGLYEKARKAVPAVRAG
FT                   AARDRAYAEPQPRPASSSVEERQPEPERQPVELQPEERSLVQEASDPRSLEAYIRRLAS
FT                   TLPVFQRYYHKKTTTGIRFVLPAGFPPPETAWVREGWIEVRGKEELSVNLTSKGLETLE
FT                   KTFVAALVRWCRVREWARRQNQERQSLLYMSEEEAETVLREYAKQLPTEGGRVRVEISL
FT                   EALGDARA"
     atgagcgtga cccggcggca gtcgttgctc gaagtgccca cctcccagaa gctcctgcgg        60
     tttctgggag gtctggtaat gctctccacc ctggccctgg ccttcggggt tggatggcag       120
     gccgcgctgg aggtggccca ggggatgctg cgggcggggt ggggagccgc gctgaaggcg       180
     tcgagccctg ccgagctgat cctgcgctgc tacggtgacc tgaccggcaa ctgcacggag       240
     gtcatgaacg gcctgtggca gaaggccctg cccctggaca ccctgcggat ggtggtggcc       300
     ggggggtttg tcctggggat gatccccttc ctgatccgcc cgcaccgccc gcgcaagctg       360
     ccggggcagg ggcggtgggc cagcgccagc gacctgaagg gttacttagg ggagggcacc       420
     ggctggtacg ggctgttcga ggggaagccg ctcagggtgc cctcgatgga gcggcgcacc       480
     gggacgctgg tggtgggcaa gcccggcggg ggcaaaacga ccggctacta ccagcccaac       540
     ttgctgctcg acgcgcggga cggctggagc gccatcgttt tcgatctcaa gtggcccgac       600
     gagggcgggc tgatggaggc gatacgctac tacagccact tcgggcgggc ggtgtatgcc       660
     tacacgccct tcgcgccggg ctcggcccgc attgccctgc tggaaggtgc ggagaacccc       720
     caggaagcca gcaacatcgc ggacatcatc gtgccccgcc tggccgacgg gggggcggag       780
     ttctacgcca acctcgagcg gatgctcctg gccgggttga tatgggtgga ggggcaggaa       840
     gggcgctact ccctgcggca catcctcgaa ctgttgcgcc agggcaagga ggagatcaaa       900
     gcctacgccg aagtccgccc acatctgaag gaccggatcg gagcggtcat gcagacccgc       960
     gaggacatca tcgccggggt ggtggcaggg ctggcaggca ggctggccct cttcgagaac      1020
     gaccatttgg atcgctcgag cctgccgggt gcaggggcgg tgccctggcc tcgcctgttc      1080
     agcgagccca gcctgcttta catcggcatc ccccaggagc acctggaagg gggcaaggcc      1140
     acggccctct tgtggctggt caagcgcatc ctggaccggg aaatccaccg ggctgctgcc      1200
     cggaacgggg ggacgcttaa agcgctcacc tcggtctacc tcgacgagtt caccgccttc      1260
     ggcaagctcc ccggcatcga ggacaacctc aagaccatgc gcagcagggg agcggccttc      1320
     cacgtgagcg tgcagaacct ggccaacggg cgctcggtat atgggcggga tgtgtgggag      1380
     agcatccagg ggacgttcgg gcagcaggtg tatctgctcg agcgcctctc ggaggaagac      1440
     cgcaaatggc tggcccggac gctggggtac gagaccgtgg tgggatactc cagaagcgcc      1500
     tccaaaatgg gcttcctctc gggcagcgag ggggagggcg agcgcgagga ggcccgcttc      1560
     ctgctttccg ccgaggagat gcgggaggtg aagaaaggcg agacggtggt gatcctggac      1620
     ggcaagccgc cggtgcgcac ctacctgggg gggatgtggg agaaaaaaca ccccctgcat      1680
     gggctctacg agaaggcccg gaaggctgtc ccggcagtgc gggcgggagc cgcccgggac      1740
     agggcctacg ccgaacccca gccccggcct gcttcctctt ccgtggaaga gcgccagcct      1800
     gagcctgaac gccagcccgt cgagctccag ccagaggagc gttctctggt gcaggaggcc      1860
     agcgatcccc gcagcctgga agcctacatc cggcgactgg cctccaccct gccggtcttc      1920
     cagcgctact accacaagaa gaccaccacc gggattcgct tcgtgctgcc cgcgggcttc      1980
     cccccacccg agacggcctg ggtgcgggag ggctggatcg aggtgcgggg caaagaggaa      2040
     ctctcggtca acctcaccag caagggcctg gagaccctgg aaaagacctt cgtggcggcc      2100
     ctggtgcgct ggtgccgggt gcgggagtgg gcccggcggc agaaccagga acgccaaagc      2160
     ctgctctata tgagcgagga ggaagccgag accgtgctca gggagtacgc caaacaactt      2220
     cccacggaag gggggcgggt gagggtcgag atttcattgg aggcgttggg cgatgcaagg      2280
     gcttga                                                                 2286
//

If you have problems or comments...

PBIL Back to PBIL home page