(data stored in ACNUC7421 zone)

EMBL: CP001743.PE516

CP001743.PE516       Location/Qualifiers
FT   CDS_pept        506527..506739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27298"
FT                   /protein_id="ADD27298.1"
FT                   /translation="MQGLEAQAFWQMLEHATWVVWDRQRRHCFVWLPGEGGRVFRYEGA
FT                   RAVQVAEGEEAVRMGRAMGVEDVAA"
     atgcaagggc ttgaggcgca ggcgttctgg cagatgctcg agcacgctac ctgggtggtg        60
     tgggacaggc agcggcggca ctgcttcgtc tggcttcccg gcgaaggtgg ccgagtgttc       120
     cgatacgagg gggctcgagc cgtgcaggtg gctgagggag aagaagcggt gcggatgggc       180
     cgggcaatgg gggtagagga tgttgcggct tag                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page