(data stored in ACNUC7421 zone)

EMBL: CP001743.PE517

CP001743.PE517       Location/Qualifiers
FT   CDS_pept        506726..507217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27299"
FT                   /protein_id="ADD27299.1"
FT                   /translation="MLRLSLTVLFLLSSLAVAETSLSEAEVTRLIAAARSEVLLEMAVF
FT                   DDRSIAEGYRVAVAERGARGYILTRGDTAEIGASYLPWASILQGTGARLIAYTRGDYAV
FT                   VDRRVALIREVRMGLPVYRLEENPAQVAALVRQFVDAYAVGRPYRIDGLVQRLGARFLR
FT                   "
     atgttgcggc ttagcttaac ggtgctgttt ctcctaagct ctctggcggt tgccgagacg        60
     agcctttcgg aagccgaggt gacccggctg atcgctgctg ctcgcagcga ggtgctgctg       120
     gagatggcgg tcttcgacga ccgctcaata gccgagggct accgggtggc ggtggcggag       180
     cggggggcca ggggctacat cctcacccgg ggggacaccg ccgagatcgg ggcctcttac       240
     ctcccctggg cttccatcct ccaggggacg ggggcaagat tgatagccta cacacgtggc       300
     gactacgccg tggtggatcg ccgggtggcg ctgatccgtg aggtgcggat ggggttgccg       360
     gtctaccggc tggaggagaa ccctgcccag gtagccgccc tggtgcggca gttcgtggac       420
     gcctacgcgg tgggccgccc ctaccgcatt gacgggctgg tgcagcgcct cggcgcacgg       480
     tttttgaggt ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page