(data stored in ACNUC7421 zone)

EMBL: CP001743.PE52

CP001743.PE52        Location/Qualifiers
FT   CDS_pept        44519..45106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0053"
FT                   /product="Chromate transporter"
FT                   /note="PFAM: Chromate transporter; SPTR: A7CMB6 Chromate
FT                   transporter; InterPro IPR003370; COGs: COG2059 Chromate
FT                   transport protein ChrA; KEGG: rpi:Rpic_0832 chromate
FT                   transporter; PFAM: Chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26834"
FT                   /protein_id="ADD26834.1"
FT                   /translation="MPRSRLFLAFLQVGLVAFGGGGQAQIYQSIVLKHRWMEEREFLET
FT                   TALCRILPGPVFANTAAHIGTRLGGVLGGVLALLGVLTPGASLMLLLSFAYFRFGAVPG
FT                   SLAEHALNGVAAAAIGLILATMLRQAPIALDSLKAIGLALVVFVTYGLLHWPLLLVLLL
FT                   TVPVGMGLYWSEAAENPAHHRAGQGMEADGRG"
     gtgccgcgca gccgactgtt tctggctttt ttgcaggtgg gtttggtggc ttttggcggg        60
     ggtggacagg cccagattta tcagagcatc gtgctcaagc accgctggat ggaggagcgg       120
     gagtttctgg aaaccaccgc gctgtgccgc atcctgccgg ggccggtgtt cgccaacacc       180
     gcggcccaca tcggaacgcg cctgggtggg gtgctggggg gggtgctggc cctgctgggg       240
     gtcttgaccc cgggggcctc cctgatgctg ctgttgagct ttgcctattt tcgctttggg       300
     gcggtgcccg gctcgctggc cgaacacgcc ctcaacgggg tggcggcggc ggccatcggg       360
     ctgattctgg ctaccatgct gcgccaggcc cccatcgcgc tggactccct caaggccatc       420
     gggctggccc tggtggtgtt tgtgacctat ggcctgctgc actggccgct gctgctggtg       480
     ctgctgctca cggtgccggt ggggatgggc ctgtactggt cggaggccgc agaaaatccg       540
     gcccaccatc gggcaggcca ggggatggag gccgatggcc gtgggtga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page