(data stored in ACNUC7421 zone)

EMBL: CP001743.PE521

CP001743.PE521       Location/Qualifiers
FT   CDS_pept        508503..509459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0528"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; SPTR: Q5VMB3 Os06g0155600
FT                   protein; InterPro IPR003593; COGs: COG3854 conserved
FT                   hypothetical protein; KEGG: Os06g0155600; hypothetical
FT                   protein; TIGRFAM: stage III sporulation protein AA"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27303"
FT                   /protein_id="ADD27303.1"
FT                   /translation="MVEAEQKSLVRVHERFPEEFARLMERLPPWVRVEVEGHRDSLDEI
FT                   VLDLGKPLIYTAADQVYVLEGRTVSKDDLSYLTHRLGGFKENNRAGLEGTLHRISRIQD
FT                   AYGETVGVTIRIGRFVMGVAEALRPWLEQTGSLLVVGPPRTGKTTLLRDIVRILAGRYG
FT                   PRVAVVDTSNEIGGDGKLTHPGISPARRLQVPDPPSKNQGWVIYQAIANHSPEVVVADE
FT                   IGYNEDVFQCLTASRRGVRVVATAHGETILDLLENPVLLPILGDPVEGKRRSRPSFAMC
FT                   LEVRGKGKFVLYPDFAEALDTLLAGGEPEGLRLGRWD"
     gtggttgaag cagaacagaa aagcctagtg cgggtacacg agcgcttccc cgaggagttc        60
     gcccgcctga tggaacgcct gccgccgtgg gtgcgggtgg aggtggaggg gcaccgggac       120
     agcctggacg agatcgtgct ggatctgggc aagcccctca tctacaccgc agcggatcag       180
     gtctacgtcc tggaggggcg cacggtgagc aaggacgacc tctcctacct gacccaccgg       240
     ctgggggggt tcaaggagaa caaccgggcg ggcctggagg gcaccctgca ccgcatttcc       300
     cgcatccagg acgcctatgg ggagacggta ggggtgacca tccgcatcgg gcgcttcgtg       360
     atgggggtgg ccgaggccct gcggccctgg ctcgagcaga ccggctccct gctggtggtg       420
     gggccgcccc gcaccggcaa gaccaccctg ctgcgggaca tcgtgcgtat cctggccggg       480
     cgctacgggc cacgggtggc ggtggtggac accagcaacg agatcggggg ggacggcaag       540
     ctcacccacc ccggcatctc ccctgcccgg cgcttgcagg tgcccgaccc gccctccaag       600
     aaccagggct gggtcatcta ccaggccatc gccaaccact cacccgaggt ggtggtggcc       660
     gacgaaatcg gctacaacga ggacgttttc cagtgcctta ccgcgagccg ccggggggtg       720
     cgggtggtgg ccaccgccca cggcgagacc atcctggacc tgctggagaa cccggtgctg       780
     ctgcccattt tgggcgaccc ggtggagggg aagcgcagaa gccgcccgtc cttcgccatg       840
     tgcctggagg tgcggggcaa ggggaagttc gtgctgtacc ccgactttgc cgaggccctg       900
     gacaccctgc tcgcgggagg tgaacccgag ggcttgcgac tggggaggtg ggattga          957
//

If you have problems or comments...

PBIL Back to PBIL home page