(data stored in ACNUC7421 zone)

EMBL: CP001743.PE523

CP001743.PE523       Location/Qualifiers
FT   CDS_pept        511091..511681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27305"
FT                   /protein_id="ADD27305.1"
FT                   /translation="MRWIYLPVLCLFLGGGSLAIDAKDFKTAYDLLRNGLCSLKITCLL
FT                   PKDMIYPADWQNDVEARLSRSREVLLIGDVQSLQPVIGYLDGWLRTSDPTRKQNRPQIF
FT                   AVVPQEQMVWFRGWTTNPELASFVKVVASSNENEPLGVVGRTGLPLVILDNQAVYMPTW
FT                   WQLEGPTLRQVLTWGRLLVDQIRSANQRRGEVK"
     atgcgctgga tctacctacc cgtgctctgc ctcttcctcg gaggaggaag tctggcgatt        60
     gatgcgaagg acttcaagac cgcctacgac ctgttgcgga acgggctgtg cagcctcaag       120
     atcacctgcc tgctgccaaa ggacatgatc tacccggcag actggcagaa cgacgtggag       180
     gcccggctgt cgcgctcgag ggaggtgctc ctgatcgggg acgtgcagtc gttgcagccg       240
     gtcatcggct acctggacgg ctggctcaga accagcgacc ccacccgcaa gcagaaccgc       300
     ccgcagatct tcgccgtcgt gccgcaggag cagatggtgt ggttccgggg gtggacgacg       360
     aaccccgagc tcgccagctt cgtgaaggtg gtggcaagca gcaacgagaa cgagccgctg       420
     ggggtggtgg ggcgcaccgg gctgcccctg gtgatcctgg ataaccaggc ggtctatatg       480
     cccacctggt ggcagcttga gggcccgacg ttgcgccagg tgctcacctg ggggcggttg       540
     ctggtggatc agatcaggtc ggccaaccag cgcagggggg aggtcaagtg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page