(data stored in ACNUC7421 zone)

EMBL: CP001743.PE525

CP001743.PE525       Location/Qualifiers
FT   CDS_pept        512076..512951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27307"
FT                   /protein_id="ADD27307.1"
FT                   /translation="MRRLALAAVAFWGLGWACTLSIETNPQGGVTGPTTVTITVRAGAT
FT                   AERLTLSLKQEGRWGDWVTSWQWSQTSTGSVSLPVNFSMNGQYILTASADLCGQPAIAQ
FT                   SRFTVMIPWTIGGGALGWLLWREAEATNYIKGLANDVNGGQPMFIEGLVTGLAEPVRAI
FT                   LRDYLVKGYLNRDQRYPPACSGLCYAIAPVQMRLYAVQGVGGLFQQGWAGLGLYGGLRD
FT                   SRSYELGTKGVAGVLIVRGYRHDYILLSARGDFSDAEITVVEMPKGGSELFRKALSLNA
FT                   LQQGAREVMP"
     atgagacgtc tggcattggc ggcggtggct ttctgggggc tggggtgggc ctgcaccctc        60
     agcatcgaga ccaatcccca gggcggggtg accggcccca caaccgtgac gatcaccgtg       120
     cgggccgggg ccacagcgga acgactcacc ctgtcgctga agcaggaggg ccggtggggg       180
     gattgggtca cttcctggca atggagccag accagcacgg gcagcgtgag cctgccggtg       240
     aacttttcca tgaacggtca gtacatcctg accgccagcg ccgacctgtg cggccagccg       300
     gccatcgccc agagccgttt cacggtgatg atcccctgga caatcggggg tggggcgctg       360
     ggctggttgc tgtggcggga ggcggaggcc accaactaca tcaaggggtt ggccaacgac       420
     gtgaacgggg gccagcccat gttcatcgag ggcctggtca ccggcctggc cgagccggtg       480
     cgggccatct tgcgggatta cctggtgaag ggctacctca accgggatca gcgctacccc       540
     ccggcgtgct cgggcctctg ctacgccatt gcgccggtgc agatgcggct ctatgcggtg       600
     cagggggtgg gcgggctgtt ccagcaggga tgggccgggc tgggcctcta cggcggcctg       660
     cgggacagcc gctcctatga gctcgggacg aaaggggtcg ccggggtgct catcgtgcgg       720
     ggctaccggc acgactacat cctgctgtcg gcccggggcg atttcagcga tgcggagatc       780
     acggtggtgg agatgcccaa ggggggcagt gagcttttcc gcaaggcgct ttccctcaac       840
     gccttgcagc agggggcgcg ggaggtgatg ccatga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page