(data stored in ACNUC7421 zone)

EMBL: CP001743.PE527

CP001743.PE527       Location/Qualifiers
FT   CDS_pept        514175..515575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0534"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; InterPro IPR001119;
FT                   KEGG: rce:RC1_0507 SMC family protein; SPTR: P35830 S-layer
FT                   protein; PFAM: S-layer homology domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27309"
FT                   /protein_id="ADD27309.1"
FT                   /translation="MPLREKRWLLAKTAVSVWSASLGLALAQQAPFKDVPPTLEDIRFL
FT                   YQKGIVQGYPDGTFRGREYMTRYQVAAMLYRTYLAFADDVARRVREALNQDAQARLEEA
FT                   LAAIEDLREGLRIVQEAMGDYPEVKANLEETRKNVEGLAEELAQVSSQMVTREEIGEII
FT                   GSVGALENLIKRGEDGLRALTARVNALEQVVRDLEQRSQAAQGELNKKVFDLGGRVDAL
FT                   EKQGKSRPKLTVGGSVGLSNGEPDGEVFVRGEANGVRLDGRLTSDGVQVRAEQGGLTLE
FT                   HRAQGGLSESRAGYRLFEGVALGLELGYGDSAFGVVRIVHEPDGGLIPGVVAEAGVGAG
FT                   FHEGNLSRNLLFVRAGYRFGAVTPSVGYYRYQGEEPYSLLEGRLDWGADFGSLGGYYRL
FT                   VAFPGSGNRGSEWGVRFTSSSNPFVELGVRGTEGLVAGEPGSFSFRYQNATASRTDFTV
FT                   RVGYRLEF"
     atgcctttgc gagaaaaacg ttggttgttg gcaaaaaccg ctgtttctgt ttggagtgcc        60
     agtctagggc tggccctggc gcagcaggcc cccttcaagg atgttcctcc caccctggag       120
     gacatccgtt ttctttacca gaagggcatc gtgcagggct accccgacgg cacgttcagg       180
     gggagggagt acatgacccg ctaccaggtt gccgccatgc tctaccgcac gtacctggcc       240
     ttcgccgacg acgtggcgcg gcgggtacgg gaggcgctga accaggacgc ccaggcccgg       300
     ctggaggagg ccctggccgc catcgaggac ttgcgggagg gcctgcggat tgtgcaggag       360
     gcgatggggg actaccccga ggtcaaggcc aacctggagg agacccgcaa gaacgtggag       420
     gggctggcgg aggaactggc tcaggtgtcc agccagatgg tgacccggga ggagattggc       480
     gagatcatcg gctcggtagg agctctggag aacctcatca agcggggcga ggatgggctg       540
     cgggccctga ccgcccgggt gaacgccctg gagcaggtgg tgcgcgacct cgagcagcgc       600
     tcccaggccg cccaggggga gttgaacaag aaagtcttcg accttggcgg acgggtggac       660
     gccctggaga agcaggggaa gagccgtccg aagctcaccg tggggggttc ggtcggactc       720
     tcgaacggcg agccggacgg ggaggtgttc gtccggggtg aggcgaacgg cgtccggctg       780
     gacggtcggc tgacctcgga cggggtgcag gtgcgggctg aacagggcgg cctcaccctc       840
     gagcaccgcg cccagggcgg gctgtcggag agccgggccg ggtatcggct gttcgagggg       900
     gtggccctgg ggctggagtt ggggtacggc gactcggcct tcggggtggt gcggatcgtg       960
     cacgagccgg acgggggcct gatccccggc gtggtggcgg aggccggggt gggggccggg      1020
     tttcacgagg gcaacctctc ccgcaacctg ctgtttgtcc gggcgggcta ccgcttcggg      1080
     gcggtgaccc ccagcgtggg ctactaccgt taccaggggg aggagcccta cagcctgctg      1140
     gaagggcggc tggactgggg ggccgacttc ggcagcctcg gggggtacta ccggctggtg      1200
     gccttccccg gaagcggaaa caggggcagc gagtgggggg tgcgcttcac ctcgagctcc      1260
     aaccccttcg tggaactcgg ggtgcggggt acggaagggc tggtggccgg tgagccgggc      1320
     agcttcagct tccgctacca gaacgccacg gccagccgga cggacttcac ggtgcgggtg      1380
     gggtacaggc tggagttcta g                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page