(data stored in ACNUC7421 zone)

EMBL: CP001743.PE528

CP001743.PE528       Location/Qualifiers
FT   CDS_pept        515585..516211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0535"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27310"
FT                   /protein_id="ADD27310.1"
FT                   /translation="MKKSVLLGGALLALLVSGCDVISGVAGEFQPAALVEVTGALEGAC
FT                   VRLEAIKDNRTAGSWTGCTEPYSFRVDLPDGAIILVGQAGRDGLVYQEGRTEASLKKGG
FT                   RTALALSRKRVSVEVTAAWLDPAKGGLAEAWMLPQEAVGVPTYADPPPASLEGRVLVAR
FT                   EVVAQGWATLSVPTGRDVAFRLVQGEAQGITRVSRLEADGKVVVL"
     gtgaaaaagt ctgtgcttct cgggggggcc ttgctggccc tcttggtctc tggatgcgac        60
     gtgatctcag gggtggccgg ggagttccag cctgccgccc tggtggaggt gacgggggcg       120
     ctcgaggggg cctgtgtccg actcgaggcc atcaaggaca accggacggc gggaagctgg       180
     acgggctgta cggagccgta cagcttccgg gtggacctgc cggacggggc gatcatcctg       240
     gtcggacagg ccggacggga tgggctggtc taccaggagg gccggacgga ggccagtctg       300
     aagaagggtg gacggacagc cctggccctc tcccgcaagc gggtgagcgt agaagtcacg       360
     gcggcctggc tcgacccggc gaagggcggt ctggccgagg cgtggatgct gccccaggag       420
     gcggtggggg tgcccaccta cgccgacccc ccgccagcga gcctggaagg gcgggtgctg       480
     gtggcccgtg aagtggtggc ccagggatgg gccaccctct ccgtgcccac cggacgggac       540
     gtggccttcc ggctggtgca gggagaggcg caagggatca cgagggtcag ccgcctggag       600
     gcggacggga aggtggtggt gctgtga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page