(data stored in ACNUC7421 zone)

EMBL: CP001743.PE53

CP001743.PE53        Location/Qualifiers
FT   CDS_pept        45099..45617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0054"
FT                   /product="Chromate transporter"
FT                   /note="PFAM: Chromate transporter; SPTR: A2W6U6 Putative
FT                   uncharacterized protein; InterPro IPR003370; COGs: COG2059
FT                   Chromate transport protein ChrA; KEGG: spe:Spro_2328
FT                   chromate transporter; PFAM: Chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADD26835"
FT                   /protein_id="ADD26835.1"
FT                   /translation="MGETLEVFLAFLRFGVLSFGGGMANLPEMARVIIGNGWVTRQEFA
FT                   DGFALGQFVPGPNMLAVLFYGLSAAGLGGALAAALGMFLPGAVGAMWLVWGWAWMSRAQ
FT                   WSRALRKALVPISMGLGASMVLVLVQLSVDSLFWGLGVLLACYLIYRGVSVVIVIAGGG
FT                   LLGLLTGLL"
     gtgggtgaaa ccctcgaggt cttcctggcc ttcctgcgct ttggggtgct tagttttggc        60
     ggaggcatgg ccaacctgcc cgagatggcc cgcgtcatca tcggcaacgg ctgggtcacc       120
     cggcaggagt ttgccgatgg ctttgccctg gggcagtttg taccggggcc caatatgctg       180
     gcggtgctgt tctatggcct gagcgctgcg gggctgggcg gggccctggc cgctgccctg       240
     ggcatgttct tgccgggcgc ggtgggggcc atgtggctgg tgtggggctg ggcctggatg       300
     tccagagccc agtggagccg ggccctgcgc aaggcgttgg tgcccatcag catgggcctg       360
     ggcgccagca tggttctggt gctggttcag ctcagcgtgg actcactctt ctggggcctg       420
     ggggtgctcc tggcctgtta cctgatttac cgcggtgtga gtgtggtaat cgtaattgct       480
     ggaggggggc tgttggggct gctgacgggg cttttgtaa                              519
//

If you have problems or comments...

PBIL Back to PBIL home page