(data stored in ACNUC7421 zone)

EMBL: CP001743.PE532

CP001743.PE532       Location/Qualifiers
FT   CDS_pept        complement(518573..519073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0539"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27314"
FT                   /protein_id="ADD27314.1"
FT                   /translation="MQRSQVYTGNMQPMSDPDLELLRGSLLEAAEALSRLAREPGPGGL
FT                   ELAAAVTQAVSELNGQVNALLLGLAARPVEPMDEAYLRYLKDLVRLRAGVMELEQLLLD
FT                   RAAFERAREEWLGLTVLLDRTLEPLIDLMTFADPSQPEADLSRGYSFDSETLGFTRVRF
FT                   KPR"
     atgcaaaggt cccaggtcta tactggcaac atgcagccca tgtctgatcc tgatctagag        60
     ttgctgcggg ggagcctact cgaggcagcc gaagcgctga gccgtctggc tcgggagcct       120
     ggcccaggag gcctcgagct cgcggccgca gtaacccagg ctgtctcgga gctgaacgga       180
     caagtcaatg ccctgctgtt gggtcttgcc gctcgaccag tggaacccat ggatgaggcc       240
     tacctgcgct acctaaagga cctggtccga ctgcgggcag gggtgatgga actcgagcaa       300
     ctcctgctcg atcgtgcagc cttcgagcga gcgcgggagg agtggctggg cttgacggtc       360
     ttgctagacc gaactttaga gccgttgatt gatctgatga cgttcgctga tcctagccag       420
     ccggaggctg acctgagccg gggctactcc ttcgacagcg agactctagg cttcacccga       480
     gtgaggttca agccgcgttg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page