(data stored in ACNUC7421 zone)

EMBL: CP001743.PE535

CP001743.PE535       Location/Qualifiers
FT   CDS_pept        complement(521773..522033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27317"
FT                   /protein_id="ADD27317.1"
FT                   /translation="MPKAIHEGTRVRFVDTDHPEDLACFLRHMAASLGEEPLLDVSGDT
FT                   VVIECQTAPRMLEFLEGCLNGRLVPVWDSNGAYFRERGPMN"
     atgcctaaag caattcacga aggaacccga gttcgcttcg ttgacaccga tcacccggag        60
     gacctggcct gctttctgcg ccacatggct gcgtcactcg gggaagagcc tctgcttgat       120
     gtttcaggcg atacggtggt tatcgaatgc cagactgccc cacggatgct cgagttcctc       180
     gaggggtgtc tcaacgggcg tctggtgccg gtatgggaca gcaacggggc ttacttccgc       240
     gagcgcggcc cgatgaacta g                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page