(data stored in ACNUC7421 zone)

EMBL: CP001743.PE537

CP001743.PE537       Location/Qualifiers
FT   CDS_pept        complement(522458..522958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0544"
FT                   /product="RES domain protein"
FT                   /note="PFAM: RES domain protein; SPTR: A3JA09 Putative
FT                   uncharacterized protein; InterPro IPR014914; COGs: COG5654
FT                   conserved hypothetical protein; KEGG: ajs:Ajs_0567
FT                   hypothetical protein; PFAM: RES domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27319"
FT                   /protein_id="ADD27319.1"
FT                   /translation="MRAWRIASRSYAHTAFTGEGAAKSPGRWNRLGVPLGVRSQSVPKG
FT                   IVPVVYLAEHLSTGILEVLVHVDDRAHLAAFVAIEVEIPDPHVEELSELPPDWRQLPEP
FT                   YPESTQRLGSEWALSLRSLALRVPSAVVPSEFNLLLNPRHPAMPEVRVGQPQPLFLDPR
FT                   LLR"
     gtgagggcct ggcgcatcgc ctcgcgcagc tacgcccaca ccgccttcac cggggaaggg        60
     gcagccaaga gccccggacg ctggaaccgc ctcggggtcc ccctgggtgt acgctcgcag       120
     agcgtcccga aggggatcgt cccggtggtg tacctggccg aacacctctc caccggcatc       180
     ctggaggtgc tggttcacgt ggacgaccgg gctcacctgg ccgcgttcgt ggccatcgag       240
     gtggagatcc ccgatcccca cgtcgaggag ctgagcgaac tgccccccga ctggcggcag       300
     ttgcccgagc cctaccccga gtccacccag aggctgggca gcgagtgggc cctgagcctg       360
     cgctccctgg ccctgcgtgt cccctcggcg gtggtcccca gcgagttcaa cctgctgctc       420
     aacccccgcc accccgcgat gcccgaggtg agggtcggcc agccccagcc gctcttcctc       480
     gacccacgcc tgctgcgcta g                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page