(data stored in ACNUC7421 zone)

EMBL: CP001743.PE542

CP001743.PE542       Location/Qualifiers
FT   CDS_pept        525948..526604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27324"
FT                   /protein_id="ADD27324.1"
FT                   /translation="MLRSKDLHMAATIDMESRTIMVSGAIDVNRVTIVMRVPIPEPGEY
FT                   TLVKAETNLTDEPWLCWQITLGEGVSLPLQNPTNLLLSRQFRKAKYLADRGAILFWDGE
FT                   VRPGDAIFKMARLNISGNYMILSHNRGGLTDGIFDEDEDESDDTGLEQDTPRIDLPGAL
FT                   DRYYEHITRHGFGDDLPKIEVETPVRIVQPGEIDILSFTNLPQAHSGGIRPRERA"
     atgctgaggt cgaaggactt gcacatggcg gctaccatcg acatggagag ccgcaccatc        60
     atggtctcag gggcgattga tgtcaaccgg gtcactatcg tcatgcgggt gccgatcccg       120
     gagcccgggg aatacacgct ggtcaaggcg gagaccaacc tgaccgatga gccctggctg       180
     tgctggcaga tcaccctcgg agaaggggtt tcgctcccgc tgcaaaaccc tacgaatctg       240
     ctgctttcgc gccaattccg caaggccaag tacctggcgg accggggcgc gatccttttc       300
     tgggatggcg aggtccgtcc gggcgacgcc atcttcaaga tggcgcggct gaacatctcc       360
     ggcaactaca tgatcctgtc gcataaccgc ggggggttaa ccgacggcat ctttgacgaa       420
     gacgaggacg agtccgacga taccgggctt gagcaggaca ccccgcggat cgacctgccc       480
     ggggccttgg accgctacta cgagcacatc acgaggcacg gcttcggtga cgatctgccc       540
     aagattgagg tcgaaacacc ggtaaggatc gtgcagcctg gggaaatcga catcctctcc       600
     ttcacgaacc tcccccaagc ccattcgggc ggcatccggc cgcgggagcg agcctga          657
//

If you have problems or comments...

PBIL Back to PBIL home page