(data stored in ACNUC7421 zone)

EMBL: CP001743.PE545

CP001743.PE545       Location/Qualifiers
FT   CDS_pept        528449..529246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0552"
FT                   /product="protein of unknown function DUF990"
FT                   /note="PFAM: protein of unknown function DUF990; SPTR:
FT                   A5MVQ5 Putative uncharacterized protein; InterPro
FT                   IPR010390; COGs: COG3694 ABC-type uncharacterized transport
FT                   system permease component; KEGG: scl:sce6748 hypothetical
FT                   protein; PFAM: Protein of unknown function (DUF990)"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27327"
FT                   /protein_id="ADD27327.1"
FT                   /translation="MTHYLALALAALRLQFATWKQYRVDYTAGVLTVLLEQALTLVLFS
FT                   VIFTHVPQVRGWTFPEMLVLYGLNRMALGLADTLGESLWWVGSYAQDGSLLLYKLRPLG
FT                   VLFQLLTERIHFERISGCLTGLILVLHGASAAGVEWTAGKVATVLLFVLLGAFIYLGLM
FT                   ILGAAVAMRVIGSLDAITTLWSLTEFAKYPLPIFGRTGAFLLTFVVPLALTGYVPAALL
FT                   LDEHTRTAGTIALAEALVAAGAFFGLCLLAWSWALRAYEGTGN"
     atgacccact acctcgccct cgcgctggcc gccctgaggc tgcaattcgc gacctggaag        60
     cagtaccggg tggactatac cgctggcgtg ctcaccgtgc tcctggagca ggccctgacc       120
     ctggtgcttt tctccgtcat cttcacacac gtgccgcaag tccgcggctg gaccttcccc       180
     gagatgctcg tgctttacgg gttgaaccga atggcgctcg gccttgccga cactctgggg       240
     gagagcctat ggtgggtcgg cagctacgcc caggacggca gcctgctgct ctacaagctc       300
     cgtccgctcg gggtactctt ccagctcctc actgagcgga tccacttcga gcggatttca       360
     ggatgcctga ccgggctgat cctggtcctc catggagcgt ccgcggccgg ggtggaatgg       420
     actgccggta aggttgccac ggtcctctta tttgttctcc tgggcgcgtt catctatctc       480
     gggctcatga tcctgggggc tgccgtagcc atgcgggtca tcggcagttt ggacgccatc       540
     acgaccttgt ggagcttaac cgagttcgcc aagtacccgc ttcccatctt cggtcgaacc       600
     ggggcctttc tcctgacgtt cgtcgtcccg ctggcgctga ccggctatgt tcctgccgct       660
     ctcctgctcg acgagcacac acgcacagca ggcaccatcg cccttgccga ggctttggtc       720
     gctgccggcg cgttcttcgg cttgtgcctg ctggcgtggt cgtgggccct ccgcgcttat       780
     gaggggactg ggaactga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page