(data stored in ACNUC7421 zone)

EMBL: CP001743.PE547

CP001743.PE547       Location/Qualifiers
FT   CDS_pept        530290..531117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0554"
FT                   /product="hypothetical protein"
FT                   /note="SPTR: P05057 Kanamycin nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27329"
FT                   /protein_id="ADD27329.1"
FT                   /translation="MHARDKPLPILRATTRRERLERARHIADWILGHYSDAVVAIGIYG
FT                   STARGSDEPYSDLEMSVLMRSSPTPGRDERYVQGLKISVEFHTVGSVYRRLQRVDLTWP
FT                   LCVDQFVSVLSLYDPEGHWPKLKLLVDQLPSGSFVQAIREGIVGELLENFAKLENARKR
FT                   DDAPAMRWIAWNLAWDVAMISALMNRAYFTSWSRTPDEILRLPSLLPAVKSLVEKFRNG
FT                   DLRSAKGLHRCCEAAVRGVVQHVATLGVHVQVEPSLAGPPREQIGGGGPGSKR"
     atgcacgcac gggacaaacc tctcccgatc ctccgagcaa ctacccgccg ggaacgcctc        60
     gagagggccc ggcacatcgc agattggatc ctgggccatt actcggacgc ggttgtggcc       120
     atcggaatct atgggtccac cgcacggggc tccgacgagc cctactccga cctggagatg       180
     tcggtcctca tgcgaagctc acccaccccc ggcagggacg agcgctacgt gcaagggctc       240
     aaaatcagcg tcgaattcca caccgtgggg tcggtctacc ggcgcctgca gcgggtagac       300
     ctgacctggc ccttgtgcgt agaccagttt gtctcggtct tatccctgta cgacccggag       360
     gggcactggc ccaagctaaa gctgctcgtt gatcagctgc cgtccggatc gttcgtgcaa       420
     gccattcgcg aggggatcgt gggggaattg ttggagaact tcgccaagct ggagaatgcc       480
     cgaaaacgcg acgacgcccc tgcaatgcga tggatcgcct ggaacctcgc gtgggatgtg       540
     gccatgatct ccgccctcat gaaccgggca tacttcacct cttggtcgcg cacacccgac       600
     gagatcctcc gactgccgtc gctgctgccc gcggttaaga gcctcgtgga gaagttccgc       660
     aacggcgatc tgcgcagcgc caaggggctc catcgttgtt gcgaagccgc agtgaggggg       720
     gttgtgcaac atgtggcaac ccttggcgtc cacgtccaag tcgaaccgtc cctggcagga       780
     cctccccggg agcagatcgg gggaggtggg cccggatcga aacgataa                    828
//

If you have problems or comments...

PBIL Back to PBIL home page