(data stored in ACNUC7421 zone)

EMBL: CP001743.PE548

CP001743.PE548       Location/Qualifiers
FT   CDS_pept        531136..531630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0555"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swi:Swit_4764 2-octaprenylphenol hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27330"
FT                   /protein_id="ADD27330.1"
FT                   /translation="MANKDTRTLEERIEELQAVVTKLFVQMDAQRIGGPGNAGAADGGE
FT                   LPDFGPWMDTTCCYARVIALRTDLQGRFQFATLKLLHDCSDERRPAWREGAIFDLRNPA
FT                   WEAELKRAQNYDLLVGVRVLPDGRVVGIELARPNKKPRASTPGVSQLRAERAPKVDKEA
FT                   P"
     atggctaata aggacacccg aacactcgag gaaaggatag aggaactaca ggcggtggtg        60
     acgaagctct tcgtccaaat ggatgcccag cgtattggag gtccggggaa tgccggtgct       120
     gctgatggcg gcgagttgcc ggactttggc ccttggatgg acacgacatg ttgctacgcc       180
     agggtcatcg cccttcggac cgacctccag ggtcgcttcc agtttgccac acttaaactg       240
     ctgcacgact gctctgatga gcgccgacct gcctggagag agggcgccat cttcgacctg       300
     cgcaacccgg cctgggaggc tgaactgaag cgagcccaga actatgacct gctggttggt       360
     gtaagggttc ttccggacgg acgagtcgtc gggatcgaac tggcacgccc taacaagaaa       420
     ccccgggcct cgacgcccgg cgtttcccag ttgcgagcgg aaagggcacc aaaagtggac       480
     aaggaggctc cgtaa                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page