(data stored in ACNUC7421 zone)

EMBL: CP001743.PE550

CP001743.PE550       Location/Qualifiers
FT   CDS_pept        complement(535182..535409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0559"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27332"
FT                   /protein_id="ADD27332.1"
FT                   /translation="MGRNWIEVRFGVLVRSFRLRQVESKSFGGLVARINLLILAHNLVR
FT                   SHVLLRMAGVGLCGSKRRYTLRGQLSFDLL"
     atggggagaa actggataga ggtgcgcttt ggcgtcctgg tcaggtcttt ccggcttcgc        60
     caagtagaga gcaagagctt cgggggcctc gtagcccgga taaacctcct catcctagcc       120
     cacaatctgg ttcgcagtca tgtcctcctc agaatggctg gggtggggct atgcggtagc       180
     aaacgaaggt ataccttacg cggtcagttg agctttgatc tgctgtag                    228
//

If you have problems or comments...

PBIL Back to PBIL home page