(data stored in ACNUC7421 zone)

EMBL: CP001743.PE551

CP001743.PE551       Location/Qualifiers
FT   CDS_pept        535533..536060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_B0302 hypothetical protein; SPTR:
FT                   Q6U9Q3 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27333"
FT                   /protein_id="ADD27333.1"
FT                   /translation="MKTYAGVGSRRAPEDVLKLMGKIARRLAERGWALRTGGAEGADRA
FT                   FERGARAGGGAVEVFLPWPGYNGYREGALKAPSPEAVRLAAALHPAWGRLSPAVQRLMA
FT                   RNSHQILGLDLNDPVAFVLCWTPDGAESEQECGPETGGTGQAIRLASRWGVPVVNLKRE
FT                   DALEKIARLVKG"
     atgaaaacct atgctggggt aggaagcagg cgtgcgcccg aggatgtgct aaagctgatg        60
     gggaagattg cccggcggct ggcggagcgg ggctgggcgc tgcgaacggg tggggcagaa       120
     ggggctgacc gggcgtttga gcggggggcc cgtgcgggcg gtggagcagt tgaggtgttt       180
     ctgccgtggc cgggatacaa cggctaccgg gaaggggcgc tgaaagcccc gagcccggag       240
     gcggtgcggc tggcggcagc attgcatccg gcctgggggc gtctgtcacc ggcggtacag       300
     cggttgatgg cccggaactc ccaccagatc ttggggctcg acctgaacga cccggtggcc       360
     ttcgtcctct gctggacacc ggacggggcc gagtcggagc aagaatgcgg gccggaaact       420
     ggtggcacgg ggcaggcgat ccggctggcc tcgaggtggg gcgtgcccgt ggtcaacctc       480
     aaaagagagg acgcgttgga gaaaatagct cggctggtca agggttga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page