(data stored in ACNUC7421 zone)

EMBL: CP001743.PE553

CP001743.PE553       Location/Qualifiers
FT   CDS_pept        536342..536563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0562"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27335"
FT                   /protein_id="ADD27335.1"
FT                   /translation="MRTTIYLPDDLARVVEAYLKEHPQTNLSALVQEALEARLRRNPAA
FT                   LLELAGVVEKASVNAGEGAEDRLYRQER"
     atgcgaacca ccatctacct gcccgatgac ctcgcccggg tggtggaggc gtacctgaag        60
     gagcaccccc agaccaacct ctcggccctg gtgcaggaag cgctggaggc ccggttgcgc       120
     cgcaacccgg cggccctttt ggagctggcc ggggtcgtcg agaaggcctc ggtaaacgcc       180
     ggggaggggg ctgaggaccg cctgtaccgc caggagcgat ga                          222
//

If you have problems or comments...

PBIL Back to PBIL home page