(data stored in ACNUC7421 zone)

EMBL: CP001743.PE556

CP001743.PE556       Location/Qualifiers
FT   CDS_pept        538793..539962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0565"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27338"
FT                   /protein_id="ADD27338.1"
FT                   /translation="MISTAIWSSRIQAALGREPRSVQEALEGLRVVLKGDEVSKEEFFQ
FT                   AAREGERFERFSRDDQVALIVWAALKEALEKTRKRLDQETPSTLVVRKDDSVKEEVRGV
FT                   KPVGTWKGPDRVYDVYLWDLKDTLRKGVQVRHPQYGSGYVQAVEGHTTTVRFACGTKKL
FT                   HTRAVRSMVVRRDWEDRRVADAKGWLERFLASAEEVRGMSRLEREDELAGNPHFSEGII
FT                   SEEVRGYLERAGYRVDPHNLEELASLVDSLPAREEKFKEGVLGITILRTRDGKAVGFRK
FT                   PGLWETKVAPDAEQESFAALIEAQGAHTVLAEMLQGEGWSVSEVRAHLSKLAKALSPAD
FT                   AKRLFGLLQEIAALRRLKVELHRAGFSPVRAVAYRDSSGEVVYTAPVYG"
     atgatcagca cggcgatctg gagcagccgg attcaggcgg ctctggggcg tgagcctcgg        60
     agcgtacagg aagccctcga gggtttgagg gtggtcctca agggagacga ggtgagcaag       120
     gaggagttct tccaggccgc acgggagggg gagcgcttcg agcgtttctc ccgcgatgac       180
     caggttgccc tcatcgtctg ggcggccctg aaggaggccc tggagaaaac ccgcaagcgc       240
     ctcgaccagg agactccctc caccctggtc gttcgcaagg acgactcggt gaaggaggag       300
     gtcagggggg tcaagcccgt gggtacgtgg aaaggcccgg atcgggtcta cgacgtgtac       360
     ctctgggact tgaaggacac cttgcgcaag ggtgtccagg tcaggcaccc ccagtacggc       420
     agcggctatg tccaggccgt ggagggtcac accaccacgg tccgattcgc ctgtggaacc       480
     aagaaactcc acaccagggc ggtgaggagc atggtcgtgc gccgcgactg ggaggatcgc       540
     cgggtggccg acgcgaaggg ctggctcgag cgcttcctgg cttccgctga ggaagtccgg       600
     gggatgagcc gcctcgagcg ggaagatgag ctcgcgggca acccgcactt ctccgaaggg       660
     attatttccg aggaggtgcg agggtacctg gaacgcgcag gctaccgcgt agacccccac       720
     aatctggagg aactggcttc gctggtggat tccctccccg ccagggaaga gaagttcaag       780
     gagggcgtcc tggggatcac tattctcaga acccgtgacg gcaaggctgt cggcttccgc       840
     aagcctggct tgtgggagac gaaagtcgct cccgacgcag agcaggaaag ctttgcagcg       900
     ctcatcgaag cgcagggggc ccacacggtt ttggcggaga tgctccaggg agagggctgg       960
     tcggtgagcg aggtgcgtgc gcacctgagc aagctggcca aggctctttc accggctgat      1020
     gcgaagcggc tgtttggtct cttacaggag atcgccgccc tccgccggtt gaaggtggag      1080
     ttgcatcgcg ccggattttc ccccgttcgg gccgtcgctt accgcgactc gagcggggag      1140
     gtcgtctaca ccgctccggt gtacggctaa                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page