(data stored in ACNUC7421 zone)

EMBL: CP001743.PE559

CP001743.PE559       Location/Qualifiers
FT   CDS_pept        541596..541775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27341"
FT                   /protein_id="ADD27341.1"
FT                   /translation="MQIELSEKEVKALLELLKEHLYYGWIEQDGEFGVVASGRASATLR
FT                   ELYRRLKGGQAKAA"
     atgcagatcg aactcagcga aaaggaagtc aaggccctgc tggagctcct caaagagcac        60
     ctgtactacg gctggattga gcaggacggg gagttcgggg tggtcgccag cgggcgggcc       120
     tcggccacgc tcagggagct ctaccggcgg ctcaaggggg gtcaggccaa agcggcctga       180
//

If you have problems or comments...

PBIL Back to PBIL home page