(data stored in ACNUC7421 zone)

EMBL: CP001743.PE560

CP001743.PE560       Location/Qualifiers
FT   CDS_pept        541799..542194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0569"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27342"
FT                   /protein_id="ADD27342.1"
FT                   /translation="MGLDLGQERARAVRALDNLLALIEEAERDLEQAQARLEGLLPLRV
FT                   VWKKKTCGNDKCRCTRGALHGPYPYLIEHREGKKIEHYLGKGWTPPEGAIAPERYNALM
FT                   QDFKSKRTRLERLMGYLDEAVEVMRRY"
     atgggtttgg atctggggca agaacgggcg cgggcggtgc gggcgctgga caacctgctg        60
     gccctgatcg aggaggccga gcgcgacctc gagcaggccc aggcccggct ggaggggctg       120
     ctgcccttgc gggtggtgtg gaagaagaag acctgtggca acgataaatg ccgctgcacg       180
     cggggggcgc tgcacgggcc gtacccctac ctgatcgagc acagggaggg gaaaaagatc       240
     gaacactatc tcgggaaggg ctggacgccg cctgaaggag ccatcgcgcc cgagcggtac       300
     aacgccctga tgcaggactt caagagcaaa agaacacgcc tggagcggct catggggtat       360
     ctggacgagg cggtggaggt catgcgcagg tattga                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page