(data stored in ACNUC7421 zone)

EMBL: CP001743.PE563

CP001743.PE563       Location/Qualifiers
FT   CDS_pept        542942..543637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mrub_0572"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mrub_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADD27345"
FT                   /protein_id="ADD27345.1"
FT                   /translation="MPRKRSRYRLEAHRLWEVLERLSLKDGLLLWEALGEDPRDFPLGK
FT                   AEALKKAKQRIRGDRMSPGITRNEGTKCPAPLRAGERRPLAKKEKRGDRVSPGKRGNQG
FT                   TERPRYPDPAGALAQELGGWRAGLLYRARKEQNGLIQKLAHQHRESLLELLNLAEGLPL
FT                   PRRIPTTLAWLEEFARELERLGDAEVLKALLEVRKRGAENPLSYAARVLAARGVQKKEE
FT                   VWTPTGEQF"
     atgccacgga agagaagccg gtatcggctt gaggcccatc ggttgtggga ggtgctcgag        60
     cggctctccc tcaaggacgg gctcttgctg tgggaggccc tgggggaaga ccccagggac       120
     tttcctttag ggaaagcgga ggcgctgaag aaggcgaaac agcggattcg gggggacaga       180
     atgtccccgg gaatcacgcg aaacgagggg acaaaatgtc ccgccccttt gcgtgctgga       240
     gaaagaagac cccttgcgaa aaaggagaaa cgaggggaca gagtgtcccc tggaaaaaga       300
     ggaaatcagg ggacagaacg tccccgttac cccgaccccg ccggagcgct ggcccaggaa       360
     ctggggggct ggcgggcggg gcttttgtac cgggcccgca aggagcagaa cgggctgatc       420
     cagaagctgg cccaccagca cagggaaagt ctgctggagc tgctgaacct ggccgagggg       480
     ctgcccctgc cgaggagaat ccccaccacc ctggcctggc tggaggagtt tgccagggag       540
     ctcgagcgcc tgggcgacgc cgaggtgctg aaggcgctgc tcgaggtgag gaagcgaggc       600
     gcggagaacc ccctgagcta cgcggcccgg gtgctggcgg cgaggggtgt gcagaagaag       660
     gaggaagtat ggacaccgac cggcgagcag ttctga                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page